BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C20 (933 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 0.91 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 1.7 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 1.7 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 2.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.0 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect(2) = 0.91 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 853 PPXXXPXPPPP 885 PP P PPPP Sbjct: 338 PPKPAPPPPPP 348 Score = 22.2 bits (45), Expect = 6.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 901 PPXPXPXPPXP 933 PP P P PP P Sbjct: 338 PPKPAPPPPPP 348 Score = 21.8 bits (44), Expect = 9.2 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 867 PGXPPPPPXXXXP 905 P PPPPP P Sbjct: 341 PAPPPPPPSSSGP 353 Score = 21.0 bits (42), Expect(2) = 0.91 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 868 PXPPPPPXPXXPP 906 P PPPPP P Sbjct: 341 PAPPPPPPSSSGP 353 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 1.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 217 AIAKCSEYLKEKXGEVIKEAVKRLIENGKRNXMDFAYQLWTKDGKEIVK 363 A+A + +K EVIK+ +K L+EN K D + D K VK Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN-KPELWDSLANKYDPDKKYRVK 118 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 1.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 217 AIAKCSEYLKEKXGEVIKEAVKRLIENGKRNXMDFAYQLWTKDGKEIVK 363 A+A + +K EVIK+ +K L+EN K D + D K VK Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN-KPELWDSLANKYDPDKKYRVK 118 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 23.8 bits (49), Expect = 2.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 217 AIAKCSEYLKEKXGEVIKEAVKRLIENGKRNXMDFAYQLWTKDGKEIVK 363 A+A + +K EVIK+ +K L+EN K D + D K VK Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN-KPELWDSLANKYDPDKKFRVK 118 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect(2) = 2.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 868 PXPPPPP 888 P PPPPP Sbjct: 1355 PPPPPPP 1361 Score = 20.6 bits (41), Expect(2) = 2.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 874 PPPPPXP 894 PPPPP P Sbjct: 1356 PPPPPPP 1362 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 3.0 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP 918 PP PPP P PP P Sbjct: 39 PPNPSQGPPPGGPPGAPPSQNP 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,242 Number of Sequences: 438 Number of extensions: 6397 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30476628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -