BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C20 (933 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 46 3e-05 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 43 3e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 42 6e-04 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.002 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 39 0.005 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 38 0.010 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 38 0.010 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 38 0.013 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 37 0.017 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 37 0.022 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 37 0.022 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 37 0.022 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.029 At4g18570.1 68417.m02749 proline-rich family protein common fami... 36 0.029 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.029 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.029 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 36 0.038 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 36 0.038 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 36 0.051 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 36 0.051 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 36 0.051 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 36 0.051 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.051 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 35 0.067 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 35 0.089 At4g01985.1 68417.m00265 expressed protein 35 0.089 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 35 0.089 At2g30560.1 68415.m03722 glycine-rich protein 35 0.089 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 35 0.089 At5g46730.1 68418.m05757 glycine-rich protein 34 0.12 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.12 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 34 0.16 At4g33660.1 68417.m04781 expressed protein 34 0.16 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.16 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 34 0.16 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 0.17 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 33 0.20 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 33 0.20 At1g61080.1 68414.m06877 proline-rich family protein 33 0.20 At3g50180.1 68416.m05486 hypothetical protein 33 0.27 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 33 0.27 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.27 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.27 At1g75550.1 68414.m08780 glycine-rich protein 33 0.27 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 33 0.27 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.27 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.36 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.36 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.36 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 33 0.36 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 33 0.36 At5g38560.1 68418.m04662 protein kinase family protein contains ... 33 0.36 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.36 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 33 0.36 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 33 0.36 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.36 At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.36 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.36 At1g70990.1 68414.m08190 proline-rich family protein 33 0.36 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 33 0.36 At1g10620.1 68414.m01204 protein kinase family protein contains ... 33 0.36 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 32 0.47 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.47 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 32 0.47 At3g51290.1 68416.m05614 proline-rich family protein 32 0.47 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 32 0.63 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 32 0.63 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.63 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 32 0.63 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 32 0.63 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 32 0.63 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.63 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 32 0.63 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 32 0.63 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 32 0.63 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 25 0.80 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 0.83 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 31 0.83 At3g55950.1 68416.m06217 protein kinase family protein contains ... 31 0.83 At3g43583.1 68416.m04636 hypothetical protein 31 0.83 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 31 0.83 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 31 0.83 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 31 1.1 At4g30460.1 68417.m04325 glycine-rich protein 31 1.1 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 31 1.1 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 1.1 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 31 1.1 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 1.1 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 31 1.1 At1g26110.1 68414.m03186 expressed protein 31 1.1 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 31 1.1 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 1.4 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 31 1.4 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 31 1.4 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 31 1.4 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 31 1.4 At2g05440.2 68415.m00575 glycine-rich protein 31 1.4 At1g29380.1 68414.m03592 hypothetical protein 31 1.4 At1g26150.1 68414.m03192 protein kinase family protein similar t... 31 1.4 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 25 1.8 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 1.9 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 30 1.9 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 30 1.9 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 1.9 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 1.9 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 30 1.9 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 30 1.9 At1g62250.2 68414.m07023 expressed protein 30 1.9 At1g62250.1 68414.m07022 expressed protein 30 1.9 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 30 1.9 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 30 1.9 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 30 1.9 At1g27710.1 68414.m03387 glycine-rich protein 30 1.9 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 30 2.5 At4g32340.1 68417.m04603 expressed protein 30 2.5 At4g21720.1 68417.m03145 expressed protein 30 2.5 At4g08230.1 68417.m01358 glycine-rich protein 30 2.5 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 30 2.5 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 30 2.5 At1g35617.1 68414.m04424 hypothetical protein 30 2.5 At1g15840.1 68414.m01901 expressed protein 30 2.5 At1g15830.1 68414.m01900 expressed protein 30 2.5 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 30 2.5 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 3.3 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 3.3 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 3.3 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 3.3 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 29 3.3 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 29 3.3 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At3g08640.1 68416.m01003 alphavirus core protein family contains... 29 3.3 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At3g04460.1 68416.m00473 Pex2/Pex12 N-terminal domain-containing... 29 3.3 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 3.3 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 3.3 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 3.3 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 3.3 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 25 3.8 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 29 4.4 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 4.4 At5g11550.1 68418.m01347 expressed protein 29 4.4 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 29 4.4 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 29 4.4 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 4.4 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 4.4 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 29 4.4 At1g62070.1 68414.m07003 expressed protein 29 4.4 At1g47660.1 68414.m05295 hypothetical protein 29 4.4 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 29 5.8 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 5.8 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 5.8 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 29 5.8 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 29 5.8 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 5.8 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 5.8 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 5.8 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 5.8 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 29 5.8 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 29 5.8 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 29 5.8 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 5.8 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 5.8 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 29 5.8 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 29 5.8 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 29 5.8 At1g13920.1 68414.m01633 remorin family protein contains Pfam do... 29 5.8 At1g02710.1 68414.m00222 glycine-rich protein 29 5.8 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 28 7.7 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 28 7.7 At5g56140.1 68418.m07003 KH domain-containing protein 28 7.7 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 28 7.7 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 28 7.7 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 28 7.7 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 28 7.7 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 28 7.7 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 28 7.7 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 28 7.7 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 28 7.7 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 28 7.7 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 28 7.7 At1g62240.1 68414.m07021 expressed protein 28 7.7 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 28 7.7 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP P P PP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP P PPPPP P PP P P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP P PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P P P PP P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P P PP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP P PP P Sbjct: 402 PPPPPPYVYPSPPPPP-PSPPPYVYPPPPPP 431 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P P P P Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP---PXPXXPPXPXPXPP 927 P PP P PPPP P P PP P PP Sbjct: 417 PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP 924 P PP P PP PP PP P P P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P PP P PP P Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPP-PYVYPPPP 429 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPX--PXXPPXPXPXPPXP 933 PP P S P PP PPPPP P P P PP P Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP P PPPPP Sbjct: 376 PPSPPPPP----PPPPPPPP 391 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP 912 P PP P PPP P P P P Sbjct: 436 PPPSPPYVYPPPPPSPQPYMYPSP 459 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P P PP P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P P PP P Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP P PP P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P P PP P Sbjct: 478 PVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXP--XXPPXPXPXPPXP 933 S P PP P PPPPP P PP P P PP P Sbjct: 425 SPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXP---PXPXPXPPXP 933 P PP P PPPPP P P P P P PP P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPPP P PP P PP P Sbjct: 437 SPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPPP PP P P PP P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P S P PP P PPP P PP P P PP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P + P P PPPPP P PPPPP Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P PP P PP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPP PP P P PP P Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXP---XPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P P P PP P Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPPPP P P P PP Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPPP P PP P PP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P S P PP PPPP P PP P PP P Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP----XPXPPXP 933 P PP P PPPPP PP P P PP P Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 35.1 bits (77), Expect = 0.067 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP PP P P P P PP P Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPX--PPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P PP PP P Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXP----PPPP 926 P + P P PPPPP P P PPPP Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP PP P P P Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P P PPPPP PP P PP P Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP-PPPXPXXPPXPXPXPPXP 933 S P PP P PP PP P P P PP P Sbjct: 562 SPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP P PP P PP P Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP P PPPP PP P P Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP----XPPXP 933 PP PPPPP PP P P PP P Sbjct: 602 PPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P PPPP PPPPP Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPPP 633 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P P P P P Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +1 Query: 853 PPXXXPXPPPP-PXPXXPPX----PXPXPPXP 933 PP P PPPP P PP P P PP P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPP 434 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP---XPPXP 933 PP P PPP P P P P PP P Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPX-PPPPPXPXXPPXPXPXPP 927 P PP P PPPP P P P PP Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXP---XPPXP 933 S P PP P PP P PP P P PP P Sbjct: 568 SSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP PPPP P P P P Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 618 PPPPPPCIEYSPPPPPP 634 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 629 PPPPPPVVHYSSPPPPP 645 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP---PXPXXPPXPXPXPP 927 P P PPPP P P PP P PP Sbjct: 552 PPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPX---PXPPXP 933 PP PPP P PP P P PP P Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P PP P P PP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP P PP P P PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PPPPP P PP P P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP P PPPPP P PP P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P F P PPPPP P PPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPP 923 P P PPPPP P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPP 906 S P PP P PPPPP P PP Sbjct: 41 SPPPPPPPPPPPPPPPPPPPPP--PP 64 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP P PP P Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP P P P P PP P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPPP P PP P P PP P Sbjct: 54 PEPEPADCPPPPPPPPCP-PPPSPPPCPPPP 83 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PPP P PP P P PP P Sbjct: 63 PPPPPPPCPPPPSPPPCPP-PPSPPPSPPPP 92 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPPP P PP P PP Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 35.9 bits (79), Expect = 0.038 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP P P P PP P Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXP--PPPPX--PXXPPXPXPXPPXP 933 P PP P P PPPP P PP P P PP P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PPP P PP P P P P Sbjct: 58 PADCPPPPPPPPCPPP-PSPPPCPPPPSPPP 87 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP PP P PP P PP P Sbjct: 76 PPPCPPPPSP-PPSPPPPQLPPPPQLPPPAP 105 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPX---PXXPPXPXPXPPXP 933 PP P P P P P PP P P PP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSP 76 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P P P P PP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCP 71 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPP--PPPXPXXPPXPXPXPPXP 933 P PP P PP PPP P P P P P Sbjct: 86 PPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 P PP P P PPPP P P P P PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPP 923 P P P P PPP P PPPP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXP 903 S P PP P PPPP P P Sbjct: 71 SPPPPSPPPPSPPPPSPPPPSPPPP 95 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP P PP P P P P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPP P PP P PP P Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPP----PXPXXPPXPXPXPPXP 933 PP P PP P P P PP P P PP P Sbjct: 148 PPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P P P P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPP PP P PP P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P PP P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P PP P Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPP 124 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPX-PXPPXP 933 PP P PPP P PP P P PP P Sbjct: 108 PPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P P P P Sbjct: 135 PYTPPPPTVKPPPPPVVTPPPPTPTPEAPCP 165 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP PP P PP P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPP---XPXXPPXPXPXPPXP 933 PP PPP P P PP P P PP P Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPP P P P PP Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P P P PPPPP P PP P P Sbjct: 154 PPPTPTPEAPCPPPPPTP-YPPPPKP 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPX-PXXPPXPXPXPPXP 933 P PP PPPP P PP P PP P Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 PP P PPP PP P P P P P P Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P P P Sbjct: 93 PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPP 123 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPP P PP P PP Sbjct: 57 PTHTPKPPTVKPPPPYIPCPPPPYTPKPP 85 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPP PP P PP Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPP 92 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXP---PPPP 926 P + P PPPPP P P PPPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P P P Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPP 115 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P PP PP P P PP Sbjct: 36 PHPVKPPKHPAKPPKPPTVKPPTHTPKPP 64 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPP---PPPXPXXPPXPXPXPP 927 P PP P PP PPP P PP P P PP Sbjct: 142 PTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPP--PPPXPXXPPXPXPXPPXP 933 P PP P PP PPP PP P P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTP 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P P P PPP P P P P P P Sbjct: 149 STPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP P P PP P Sbjct: 72 PHPKPPTVKPHPKPPTVKPHPKPPTVKPPHP 102 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP----PXPXXPPXPXPXPPXP 933 P PP P P PP P P P P P P P Sbjct: 81 PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPP 115 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 S P PP P PP PPP PP P PP P Sbjct: 126 STPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKP-PPTP 162 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P P P P P P P PP Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP PP P P P P Sbjct: 218 PTPTPPVVTPPTPTPPV-VTPPTPTPPTPIP 247 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 P PP P PPP P P P P P P Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKP 141 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PP PP P PP P PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 31.9 bits (69), Expect = 0.63 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP PPPPP Sbjct: 78 PALPPPPPKKVSSYCPPPPP 97 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPP P P P PP P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPP 78 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP 912 P PP P P PP P PP P Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPP 84 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P P P PPPP PP P P PP P Sbjct: 54 SPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPP PP P P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPP-XPXPXPPXP 933 P PPPPP P P P P PP P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSP 69 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PP PP P P P P P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPP 71 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P P P PP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPP 72 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP PP PP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSP 81 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP PP P P PP P P Sbjct: 66 PPSPPPPKKSSCPPSPLPPPPPPPPP 91 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/83 (30%), Positives = 28/83 (33%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G G G G GG G GGGG G GG+ + G GG Sbjct: 99 GGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGG-GGG 157 Query: 752 WHXXGGXGGXGRRTXGXLSXXGG 684 + GG GG G G GG Sbjct: 158 YGGGGGYGGGGGGYGGGGRGGGG 180 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGG 852 G GG G GG G GGGG G GG Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGGGGG 183 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP P PP P P PP P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPPP P PP P P P Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 P PP P PPPP P P PP PP P Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P PPPP P PPPPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPP 282 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPPP PP P P Sbjct: 280 PPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P P PP P P P PP Sbjct: 273 PPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPPPP P P P P P Sbjct: 586 SIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP 620 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPPP P P PP P Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 4/59 (6%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXP----PPPPXPXXPPXPXPXPPXP 933 PP P P PP P P PPP PP P P PP P Sbjct: 548 PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPP 923 P PPPPP P PPPP Sbjct: 714 PPPPPPPPLSKTPAPPPPP 732 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP P P P PP P Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P P PP P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAP 701 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 5/31 (16%) Frame = +3 Query: 849 FXPXXXPGXPPPPP-----XXXXPXXPPPPP 926 F P P PPPPP P PPPPP Sbjct: 499 FSPSQPPPPPPPPPLFMSTTSFSPSQPPPPP 529 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 5/31 (16%) Frame = +3 Query: 849 FXPXXXPGXPPPPP-----XXXXPXXPPPPP 926 F P P PPPPP P PPPPP Sbjct: 520 FSPSQPPPPPPPPPLFTSTTSFSPSQPPPPP 550 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPP 923 PPPPP P PPPP Sbjct: 728 PPPPPLSKTPVPPPPP 743 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPX---PPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P P P P PP P Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 716 PPPPPPLSKTPAPPPPP 732 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 8/33 (24%) Frame = +1 Query: 853 PPXXXPXPPPPP--------XPXXPPXPXPXPP 927 P P PPPPP P PP P P PP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P P PP Sbjct: 714 PPPPPPPPLSKTPAPPPP 731 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 701 PPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 5/30 (16%) Frame = +1 Query: 853 PPXXXPXPPPPP-----XPXXPPXPXPXPP 927 P P PPPPP PP P P PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +1 Query: 868 PXPPPPPX---PXXPPXPX---PXPPXP 933 P PPPPP P PP P P PP P Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PP PP P P P PP P Sbjct: 1061 SPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 35.1 bits (77), Expect = 0.067 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP P PP P PP P Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 34.7 bits (76), Expect = 0.089 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 849 FXPXXXPGXPPPPPXXXXPXXPPPPP 926 F P P PPPP P PPPPP Sbjct: 1100 FPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP PP P P PP P Sbjct: 1101 PPLPPP---PSQPPPPPLSPPPSPPPPPPPP 1128 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPP-PPXPXXPPXPXPXPP 927 P PP PPP PP P PP P P P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLP 1087 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPP 923 P P PPPPP P PPPP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 P P PPPPP PP P P PP P Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 PP P PPP PP P P P P P P Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPP--XPXPXPPXP 933 P P P PPPP PP P P PP P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P P PPP P PPPPP Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP----XPXPPXP 933 P P P PP PP PP P P PP P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P P PP P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPPP P P P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPP 327 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 PP P PP PPP P P P PP P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPP 906 P P PPPPP P PP Sbjct: 25 PSPLPLPPPPPPPLKPP 41 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXP 924 P P PPPPP P P P P Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPP 328 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 36.3 bits (80), Expect = 0.029 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXP 924 PP P PPPPP PP P P P Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEP 87 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PPPP P PP P PP Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPP 80 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPP P P P PP Sbjct: 66 PQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXP 924 P PPPPP P P P P P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSP 85 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P P PP P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP P P PP P Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPPP P P P PP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 35.9 bits (79), Expect = 0.038 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGG 852 G GG G G G G GGGGG G GG Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 Query: 923 GXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G GG G GGGGG G GG+ G Sbjct: 211 GGGGGLGGGNGSGGGGG-GGGGGGRISG 237 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 GGGGG G GGGGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGG 230 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.9 bits (79), Expect = 0.038 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP PP P PP P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPPP PP P PP P Sbjct: 601 SPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPP PP P PP P Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPX--PPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP PP P PP P Sbjct: 523 PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 P PP P PP PPP PP P PP P Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPPP PP P PP Sbjct: 638 SPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 594 SPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPP PP P PP P Sbjct: 608 SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP PP P PP P Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPPP PP P PP P Sbjct: 572 SPPPPVHSPPPPVYSPPPPPV-HSPPPPVHSPPPP 605 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P PP P Sbjct: 591 PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPX---PXXPPXPXPXPPXP 933 PP PPPPP P PP P PP P Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPX---PXXPPXPXPXPPXP 933 PP PPPPP P PP P PP P Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPP P PP P PP P Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPP 521 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P S P PP PPPP PP P PP Sbjct: 531 PPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 PP P PPP PP PP P PP P Sbjct: 582 PPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 634 PPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP---XPPXP 933 P PP P PPP P P P P PP P Sbjct: 497 PVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPP 530 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 568 PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P S P PP PPPP PP P PP Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 558 SPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 PP P PP P P PP P PP P Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPX-PXXPPXPXPXPP 927 PP P S P PP PPPP P PP P PP Sbjct: 611 PPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 840 PXXFXPXXXPGX--PPPPPXXXXPXXPPPPP 926 P + P P PPPPP P PPPPP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSP--PPPPP 541 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPP-XPXXPPXPXPXPP 927 S P PP PPPP P PP P PP Sbjct: 565 SPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P PPPP P PPPPP Sbjct: 497 PVHSPPPPSPIHSPPPPPVYSP--PPPPP 523 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPPP P PP P P Sbjct: 374 PPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 32.3 bits (70), Expect = 0.47 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP PPPPP P P P P Sbjct: 369 PRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P P P PP P PP P Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P P PPPPP P PP P PP Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPP--PPLAPPPPP 394 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXX---PPXPXPXPPXP 933 P P PPPPP P PP P P PP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPP 33 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PP PP P PP P P Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +1 Query: 841 PXXXPPXXXPXPPP-----PPXPXXPPXPXPXPP 927 P P P PPP PP P PP P P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLP 37 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P PG PPPP P PPPPP Sbjct: 682 PPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP PP P PP P Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGGPPPP 701 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPX---PXPPXP 933 P P PPPPP PP P P PP P Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP PPPPP PP P P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPP P P P P PP Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPP 923 P G PPPPP PPPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPP 694 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXX---PPXPXPXPPXP 933 PP P PP PP P PP P P PP P Sbjct: 530 PPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPP 927 P PP P PPP P PP P P PP Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPP 543 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPP 923 PPPPP P PPPP Sbjct: 528 PPPPPLSPPPPSPPPP 543 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P + P PPPP PPPPP Sbjct: 609 PPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P PP P Sbjct: 694 PVYYPPVTQS-PPPPPVYYLPVTQSPPPPSP 723 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P P PPP P P PP P P P P P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 34.7 bits (76), Expect = 0.089 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 853 PPXXXPXPP-PPPXPXXPPXPXPXPP 927 PP P PP P P P PP P P PP Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P PPP P P PP P P P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSP 54 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 PP P P PPP P P P P P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCP 52 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 PP P P PPP P PP P P P P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP P P P P P P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP P P P P P PP P Sbjct: 82 PPEPKPAPPPAPKPVPCPSP-PKPPAP 107 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P P PP P P P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 109 PKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PPP P P P P PP P Sbjct: 30 PCPSPPPK-PQPKPPPAPSPSPCPSP-PPKP 58 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P PP P PP P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P P P P P P P P P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACP 69 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXP-XPPXP 933 P P P PPP P P P P PP P Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPACPPTP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P PP P P P P Sbjct: 85 PKPAPPPA-PKPVPCPSPPKPPAPTPKPVPP 114 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PP PP P P P PP Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P P P P P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPP--PPPXPXXPPXPXPXP-PXP 933 P P P PP PPP P P P P P P P Sbjct: 102 PKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P PP P P P Sbjct: 50 PCPSPPPK-PQPKPVPPPACPPTPPKPQPKP 79 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P P P P P P P P P P P P Sbjct: 66 PACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP P P P P P P P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPP 43 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P PP PP P P P P P P P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAP 89 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P P P P P P P P P P P P Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P P P P PP P Sbjct: 77 PKPAPPPEPK-PAPPPAP--KPVPCPSPPKP 104 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 35.1 bits (77), Expect = 0.067 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P PP P Sbjct: 515 PPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P P PP P Sbjct: 506 PPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P P PP P Sbjct: 617 PLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P P PP P Sbjct: 632 PVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 849 FXPXXXPGXPPPPPXXXXPXXPPPPP 926 + P P PPP P P P PPP Sbjct: 604 YYPQVTPSPPPPSPLYYPPVTPSPPP 629 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPX-PXPXPPXP 933 P P PPPP PP P P PP P Sbjct: 606 PQVTPSPPPPSPLYYPPVTPSPPPPSP 632 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 587 PVYYPPVTYSPPPPSPVYYPQVTPSPPPPSP 617 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP P P PP P Sbjct: 527 PSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 557 PVYYPPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXP--XPXPPXP 933 PP P PPPP PP P PP P Sbjct: 459 PPPPSPSPPPPYVYSSPPPPYVYSSPPPP 487 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 572 PVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXX----PPXPXPXPPXP 933 PP P PP PP P PP P P PP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 7/34 (20%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXX-------PPXPXPXPPXP 933 P P PPPPP P PP P P PP P Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 868 PXPPPPPXPXXPPXP 912 P PPPPP P PP P Sbjct: 728 PPPPPPPPPPAPPTP 742 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P + P P PPPP PP P P PP P Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPP---PPPPPPAPPTP 742 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPP P P P PP Sbjct: 771 PPPTAPPPPPLGQTRAPSAPPPPPP 795 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 34.7 bits (76), Expect = 0.089 Identities = 24/81 (29%), Positives = 26/81 (32%) Frame = -2 Query: 923 GXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSKWHX 744 G G G G G GGGGG G GG G G G K Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGS--GGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRG 109 Query: 743 XGGXGGXGRRTXGXLSXXGGS 681 G GG G G + GG+ Sbjct: 110 RKGGGGAGGGVGGGVGAGGGA 130 Score = 31.9 bits (69), Expect = 0.63 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G G G GG G G GGG G GG G G GG S Sbjct: 262 GGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGG---GGSVGGGGRGSG 318 Query: 752 WHXXGGXGGXGRRTXGXLSXXGG 684 G GG G + GG Sbjct: 319 GASGGASGGASGGAGGSVGAGGG 341 Score = 31.5 bits (68), Expect = 0.83 Identities = 27/93 (29%), Positives = 29/93 (31%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G GG G G G GG GG GG+ G G G GG V Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Query: 752 WHXXGGXGGXGRRTXGXLSXXGGSRYQWC*RGS 654 G G G G + GG RGS Sbjct: 286 VGGSVG-GAVGGAVGGAVGGGGGGSVGGGGRGS 317 Score = 31.1 bits (67), Expect = 1.1 Identities = 29/87 (33%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGG-----GGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHV 762 GG G G GG GGG GG G GGK G G GG + Sbjct: 138 GGIGGGAGG--AIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGI 195 Query: 761 XSKWHXXGGXGGXGRRTXGXLSXXGGS 681 S GG G G R G S GG+ Sbjct: 196 GS---GGGGTVGAGGRGSGGASGGGGT 219 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSKWH 747 GG G G GG G GG G GG G G G GG Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGS-VGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Query: 746 XXGGXGGXGRRTXGXLSXXGG 684 GG GG G GG Sbjct: 411 GVGGAGGAGGSVGAGGGVGGG 431 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 GG G G GG G GG G GG G Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGG 462 Score = 29.1 bits (62), Expect = 4.4 Identities = 22/82 (26%), Positives = 25/82 (30%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSKWH 747 GG G G G G GGG GG+ G G G Sbjct: 183 GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGG 242 Query: 746 XXGGXGGXGRRTXGXLSXXGGS 681 GG G G R G + GG+ Sbjct: 243 SGGGSVGGGGRGSGGVGASGGA 264 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 926 GGXGXGXGGXXGX--GGGGGXGXXXGGKXXG 840 GG G GG G GGGGG GG+ G Sbjct: 438 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSG 468 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 34.7 bits (76), Expect = 0.089 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXP-PXPXPXPP 927 PP P PP PP P P P P P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPPXP 933 PP PP P PP P P P Sbjct: 73 PPKPPEPPKPPEPEKPKPPP 92 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G GG GG GG GGK G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGG 108 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G GG G GGGG G GG G Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G G G GGG G GGK G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG 45 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G G GG G GGG G GGK G Sbjct: 87 GGGISGGGAGGKSGCGGGKSGGGGGGGKNGG 117 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGG--GGGXGXXXGGK 849 G G G G G G GG GGG G GGK Sbjct: 97 GKSGCGGGKSGGGGGGGKNGGGCGGGGGGK 126 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 917 GXGXGGXXGXGGGGGXGXXXGGK 849 G G GG G GGGG G GGK Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGK 98 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 917 GXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G G G GGG G GG+ G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGG 28 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 34.7 bits (76), Expect = 0.089 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P PPP P P P PP P Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPP P PP P PP Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P P P PPPPP P P PP P Sbjct: 19 SLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P PP P PP Sbjct: 72 PPPPPPPSAPPPLVPDPP 89 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G G G G GGGGG G GG G Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGG 267 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G G GG G GGGGG GG+ G GG Sbjct: 113 GGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGG---GG 169 Query: 752 WHXXGGXGGXGRRTXGXLSXXGG 684 H GG GG G GG Sbjct: 170 GHGGGGGGGSAGGAHGGSGYGGG 192 Score = 33.1 bits (72), Expect = 0.27 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G GG G G G GGG G G GG G G G G H Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYG-GGGAHGGGY 233 Query: 752 WHXXGGXGGXGRRTXGXLSXXGG 684 G GG G G GG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGG 256 Score = 31.9 bits (69), Expect = 0.63 Identities = 25/73 (34%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Frame = -2 Query: 932 GXGGXGXGXGGXXGX--GGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVX 759 G GG G G GG G GGGGG GG G E G G G+ Sbjct: 105 GEGGGG-GYGGAAGGHAGGGGGGSGGGGGSAYGAGGE-HASGYGNGAGEGGGAGASGYGG 162 Query: 758 SKWHXXGGXGGXG 720 + GG GG G Sbjct: 163 GAYGGGGGHGGGG 175 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/73 (27%), Positives = 22/73 (30%) Frame = -2 Query: 923 GXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSKWHX 744 G G G GG G GG G GG G G GG + + Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGN-GAGEGGGAGASGYG 161 Query: 743 XGGXGGXGRRTXG 705 G GG G G Sbjct: 162 GGAYGGGGGHGGG 174 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 GG G GG G GGG G G GG+ G Sbjct: 245 GGAAGGYGG--GGGGGEGGGGSYGGEHGG 271 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P PP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPPPP PP PP P Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPX--PXXPPXPXPXPPXP 933 P PP PPPPP P PP P PP P Sbjct: 539 PVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P PP P Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 574 SPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 581 SPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 567 SPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPPP PP P PP Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P PP P PP P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPP---PPPXPXXPPXPXPXP 924 P PP P PP PPP P P P P P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PP P PP P PP P Sbjct: 591 PPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXP--XPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPPP PP P PP P Sbjct: 588 SPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP PP P PP P Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPPP-XPXXPPXPXPXPPXP 933 PP PPPP P PP P PP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PPPP PP P PP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 P PP PP PPP PP P PP P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPPP PP PP Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PP PP PP P PP P Sbjct: 630 PSQSPPVVYSPPPRPPKINSPPVQSP-PPAP 659 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXX--PXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P P PP P Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P P PP P Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPP 46 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P P PPPPP PPPPP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPP 45 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPP P P P PP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P P PPPP P PPPPP Sbjct: 24 PPPPPP-PPPPMRRRAPLPPPPPP 46 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPP 906 P PP P PPPPP P PP Sbjct: 23 PVGVPPQYYPPPPPPPPPPPPP 44 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 855 PXXXPGXPPPP---PXXXXPXXPPPPP 926 P P PPPP P P PPPPP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPP 39 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP----PXPXXPPXPXPXPPXP 933 P P PPPP P PP P P PP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +1 Query: 853 PPXXXPX---PPPPPXPXXPPXP 912 PP P PPPPP P PP P Sbjct: 22 PPVGVPPQYYPPPPPPPPPPPPP 44 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP P PP PP P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSP 431 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPP P PP P P P Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPP 432 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPP-PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P P P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP P P PP P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P PPPP PPPPP Sbjct: 432 PVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPPXP 933 P PP PP P P PP P Sbjct: 403 PSPPIVALPPPPPPSPPLP 421 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP--PXPXXPPXPXPXPPXP 933 P PP P PPP P P PP P PP P Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP P PP P PP P Sbjct: 86 PRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PP PP PP P PP P Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PPP P P P P PP Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP PP P PP P Sbjct: 38 PLSPPPSPPPSPSSPPR-LPPPFPALFPPEP 67 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPP 923 P P PPPPP P PPPP Sbjct: 96 PEEPPREPPPPPP--PPEEPPPP 116 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP 912 P PP P PPPPP P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKP 267 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PP P P PPPPP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPP P PP P P Sbjct: 244 PPQQPPATPPPP-PPPPPVEVPQKP 267 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PP P PP P P PP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 Score = 27.5 bits (58), Expect(2) = 0.17 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 853 PPXXXPXPPPPPXP 894 PP P PPPPP P Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 27.5 bits (58), Expect(2) = 0.17 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 853 PPXXXPXPPPPPXP 894 PP P PPPPP P Sbjct: 381 PPPSPPPPPPPPPP 394 Score = 25.0 bits (52), Expect(2) = 0.17 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P PP Sbjct: 301 PPPPPPPPPQPLIAATPP 318 Score = 25.0 bits (52), Expect(2) = 0.17 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPPPP P PP Sbjct: 421 PAPPPPPPPRYTQFDPQTPP 440 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P P PP P Sbjct: 347 PSPPPPPPVIQPELPQPQPPPP 368 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G GG G GG G GGGG GG+ G G G GG Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 156 Query: 752 WHXXGGXGG 726 GG GG Sbjct: 157 GGYGGGEGG 165 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGG-GGGXGXXXGGKXXG 840 G GG G G G GG GGG G GG G Sbjct: 142 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 28.7 bits (61), Expect = 5.8 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSK 753 G GG G GG GGGG GG G G GG S Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG---------GGYSGGGGGYSS 140 Query: 752 WHXXGGXGGXGRRTXG 705 GG G GRR G Sbjct: 141 RGGGGGSYGGGRREGG 156 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P PP P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P P PP P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPP 530 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P P P PP P Sbjct: 513 PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P PP P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P P P PP P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P P P PP P Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 840 PXXFXPXXX--PGXPPPPPXXXXPXXPPPPP 926 P F P P PPPPP PPPPP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPP 527 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP P P P PP P Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPX----PPPPPXPXXPPXPXPXPPXP 933 P PP P PPPPP P P PP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P PP P Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P PP P Sbjct: 590 PPPPPPPMPLANGATPPPPPPP 611 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP 918 PP P PPPPP P PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPP P P PP P P PP Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 880 PPPXPXXPPXPXPXPPXP 933 PPP P PP P P PP P Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPPPP P PP P P Sbjct: 27 PQPPPPPPPPPPPPPPRLGP 46 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPP 906 P PP P PPPPP P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP P P PP P Sbjct: 10 PPPLPPRLELRRQRAPPPQPPPPPPPPPPPP 40 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P P PPPP P PP P PP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPP 127 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P PP P P P P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVP 109 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP P PP P P P P Sbjct: 163 PSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P PP P PP P Sbjct: 175 PSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPP-PPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP--PPPXPXXPPXPXPXPPXP 933 S P P P PP PPP P P P PP P Sbjct: 134 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P P P PP P P P P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVP 127 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P P P P PP P P P P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPP--PXPXXPPXPXPXPPXP 933 S P P P PP P P P PP P PP P Sbjct: 152 SPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PP P P PP P PP P Sbjct: 195 PPDVTPTPPTPSVPS-PPDVTPTPPTP 220 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PP P P PP P PP P Sbjct: 210 PPDVTPTPPTPSVPS-PPDVTPTPPTP 235 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPP P PP P P P P Sbjct: 170 PTDPMPSPPPPVSP-PPPTPTPSVPSP 195 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P P Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PP P P P P PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTP 104 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXP----PPPPXPXXPPXPXPXPPXP 933 P PP P P P PP PP P P P P Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP--PPPXPXXPPXPXPXPP 927 S P P P PP PPP P P P PP Sbjct: 98 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXP----PPPPXPXXPPXPXPXPPXP 933 P PP P P P PP PP P P P P Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 147 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP--PPPXPXXPPXPXPXPP 927 S P P P PP PPP P P P PP Sbjct: 116 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPP--PPPXPXXPPXPXPXPP 927 P P P PP PPP P P P PP Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPP-PPXPXXPPXPXPXPPXP 933 P PP P P PP PP P P P P Sbjct: 80 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSP 111 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P PP P Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P PP P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P PP P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P P PP P Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSP 73 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGG 875 GGGGG WG GGGGG Sbjct: 87 GGGGGGWGWGGGGGGGG 103 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGGG G GGGGG G G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGGG G GGGGG G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGGG G GGGGG G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 927 GGXGXGXGGXXXXGGGGGXRXXXGGXXXXXXXXXXXXGREXCGG 796 G G G GG GGGGG GG + CGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPP--PPPXPXXPPXPXPXPPXP 933 PP P P PPP P P P P PP P Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPP P PP P P PP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 P PP P P P PP P PP PP P Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 P PP P PP P P P P PP P Sbjct: 154 PESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 PP P PP PP P P P P PP P Sbjct: 577 PPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 551 SPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPP 585 Score = 32.3 bits (70), Expect = 0.47 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 PP P S P PP P PP PPP PP P PP P Sbjct: 554 PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPP PP P PP P Sbjct: 601 SPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P PP P Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P PP P Sbjct: 598 PVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PP P PP P PP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPP-PPXPXX-PPXPXPXPPXP 933 PP P P P PP P PP P PP P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P + P PPPP PPPPP Sbjct: 570 PHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP PP P Sbjct: 544 SPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPP 578 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP--PPPXPXXPPXPXPXPP 927 S P P P PP PP P PP P P PP Sbjct: 161 SPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P PP P PP P Sbjct: 165 PPFSPSIPPPSPPYFPPEPPSIPPPP 190 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXP--PPPP 926 P P P PPP P P P PPPP Sbjct: 160 PSPDFPPFSPSIPPPSPPYFPPEPPSIPPPP 190 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 932 GXGGXGXGXG-GXXGXGGGGGXGXXXGGKXXG 840 G GG G G G G G GGGG G GG+ G Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSG 80 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 932 GXGGXGXGXG-GXXGXGGGGGXGXXXGGKXXG 840 G GG G G G G G GGGG G GG+ G Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSG 80 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 24 PAPKPPKPKPAPAPTP-PKPKPTPAPTPPKP 53 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 35 PAPTPPKPKPTPAPTP-PKPKPKPAPTPPKP 64 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 46 PAPTPPKPKPKPAPTP-PKPKPAPAPTPPKP 75 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 57 PAPTPPKPKPAPAPTP-PKPKPAPAPTPPKP 86 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 68 PAPTPPKPKPAPAPTP-PKPKPKPAPTPPNP 97 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P PP P Sbjct: 79 PAPTPPKPKPKPAPTP-PNPKPTPAPTPPKP 108 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP 924 P PP P P P P P P P P P Sbjct: 101 PAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P P P P P P P P P P P P Sbjct: 97 PKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP-PXP 933 P P P P P P P PP P P P P P Sbjct: 86 PKPKPAPTPPNPKPTPAP-TPPKPKPAPAPAP 116 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP 924 P P P P P P P P P P P Sbjct: 103 PTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPP 927 P PP P P PPPP P P P PP Sbjct: 52 PHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 841 PXXXPPXXXPXP---PPPPXPXXPPXPXPXP 924 P PP P P PPPP PP P P P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PP P P P P P PP P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PPP P P P P P P Sbjct: 46 PPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P P PPPP P PPP P Sbjct: 36 PPFSPPHHPPPPHFSPPHQPPPSP 59 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 7/33 (21%) Frame = +1 Query: 856 PXXXPXPPPP---PXPXXPPXP----XPXPPXP 933 P P PPPP P P PP P P PP P Sbjct: 59 PYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPP PP P P P Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHP 44 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 853 PPXXXPXPPPPPX--PXXPPXPXPXPP 927 PP PPPPP P PP P PP Sbjct: 26 PPPSHISPPPPPFSPPHHPPPPHFSPP 52 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P P P PP P P P P Sbjct: 32 SPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPP 66 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P PP P P P P Sbjct: 47 PHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PP P PP P P PP Sbjct: 118 PPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP PP P Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P P P Sbjct: 45 PQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PP P PP P PP P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPPAP 128 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P P P P PP PP P PP P Sbjct: 124 SPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP PP P P P Sbjct: 36 PPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P P P Sbjct: 109 PPQTVSPPPPPDASPSPPAPTTTNPPP 135 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP P PPPPP Sbjct: 37 PPPPPVYSPPISPPPPP 53 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXP 894 P PP P PPPPP P Sbjct: 41 PVYSPPISPPPPPPPPPP 58 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 70 PPPPPSKYGRVYPPPPP 86 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPP-PPPXPXXPPXPXPXPP 927 S P PP P PP PP P PP P PP Sbjct: 1125 SPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPP-PPPXPXXPPXPXPXPP 927 P PP PP PPP P P P PP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPP 1151 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPPP PP P P P Sbjct: 206 PPIPSAYPPPPPSSAYPPQPYPPQP 230 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 773 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP PP P PP P Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPPP PP P PP P Sbjct: 669 SPPPPVYSPPPPVHSPPPPPV-HSPPPPVHSPPPP 702 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPP PP P PP P Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPPP PP P PP P Sbjct: 780 SPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPX-PXXPPXPXPXPPXP 933 S P PP PPPPP PP P PP P Sbjct: 719 SPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP PP P PP P Sbjct: 755 PVHSPPPPVHSPPPPPV-HSPPPPVHSPPPP 784 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 687 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPP---PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 S P PP PPPP P P P P PP P Sbjct: 726 SPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPX-PPPPPXPXXPPXPXPXPPXP 933 P PP P PPPP PP P PP P Sbjct: 738 PVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPP PP P PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPP 666 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 S P PP PPPP P PP P PP P Sbjct: 712 SPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 PP P PP PPP PP P PP P Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 PP P PPP PP PP P PP P Sbjct: 679 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 705 SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 PP P PPP PP PP P PP P Sbjct: 761 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 655 SPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 691 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 698 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPP PP P PP Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPP PP P PP Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPX-PXXPPXPXPXPP 927 PP P S P PP PPPP P PP P PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 S P PP PPPP PP P PP Sbjct: 787 SPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPP 819 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPP PP P P P P Sbjct: 794 SPPPPVHSPPPPSPIYSPPPPVFSPP-PKPVTPLP 827 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP P PPPPP Sbjct: 268 PPPPPGSWQPSPPPPPP 284 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 875 PPPPPXXSXPPXPXPXPP 928 PPPPP S P P P PP Sbjct: 267 PPPPPPGSWQPSPPPPPP 284 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXP 918 P PPPPP P PP P P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXP 924 PPPPP P P P P P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPP PP P P P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXP----PPPPXPXXPPXPXPXPPXP 933 P PP P P PPPP P PP PP P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP PP P P P PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP---XPXPPXP 933 P P PPP P P PP P P PP P Sbjct: 81 PIKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLP 114 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PPPPP P PP P P Sbjct: 15 SPYSPHLHPPSA-PLPPPPPLPPPPPPRQSHPESP 48 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P PP P P PP P P PP Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLPPPPPP 40 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP P P P PP P Sbjct: 69 PPNQPPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPP P P P PP Sbjct: 74 PNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PP PP P PP P P Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPP P PP P P PP Sbjct: 266 PPPPSSPPPPPPPPPTPP 283 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXP 903 P PP P PPPPP P P Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPP 906 P PP PPPPP P PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPPXP 933 P PP P PP P P PP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTP 282 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPP P PPP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTP 282 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P F P PPPPP P PPPP Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPP--PXPXXPPXPXPXPPXP 933 S P PP PPPP P P P P P P P Sbjct: 74 SPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 875 PPPPPXXSXPPXPXPXPP 928 PPPPP S PP P PP Sbjct: 67 PPPPPIYSPPPPPIYPPP 84 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 42 PPPPPYRSPVTIPPPPP 58 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPP--PXPXXPPXPXPXPPXP 933 PP PPPP P P P P P P P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPP----PPXPXXPPXPXPXPPXP 933 P P P PPP PP P PP PP P Sbjct: 58 PVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPP 92 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP P PPPP Sbjct: 54 PPPPPVYSRPVAFPPPP 70 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P P PPP P P P P P P Sbjct: 158 SSDPPLPPPPPPYPSPLPPP-PSPSPTPGPDSPLP 191 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP P PPP P Sbjct: 161 PPLPPPPPPYPSPLPPPPSP 180 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXP----PXPXPXPPXP 933 P PP P PPPP P P P P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P PPP P P P P P Sbjct: 191 PSPGPDSPLPLPGPPPSPSPTPGPDSPLPSP 221 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P PPP P P P P P Sbjct: 238 PTPGPDSPLPSPGPPPSPSPTPGPDSPLPSP 268 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P P P P P P P Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLP 247 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXP-PXPXPXPPXP 933 P P P P P P P P P P PP P Sbjct: 253 PSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPP 906 PP P PPPPP P PP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 868 PXPPPPPXPXXPPXP 912 P PPPPP P PP P Sbjct: 71 PSPPPPPPPRPPPPP 85 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPP 927 PP P P PP P P PP Sbjct: 68 PPSPSPPPPPPPRPPPP 84 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 883 PPXPXXPPXPXPXPPXP 933 PP P PP P P PP P Sbjct: 68 PPSPSPPPPPPPRPPPP 84 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P PP P P P P Sbjct: 69 PSPSPPPPP--PPRPPPPPLSP 88 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPPP P P P P P Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +1 Query: 853 PPXXXPXPPPP----PXPXXPPXP-XPXPPXP 933 PP P PPP P P PP P P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPP---XPXXPPXPXPXPPXP 933 P P P P PPP P PP P P P P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPP P P P P PP Sbjct: 389 PPPAPPPGSGGPKPPP-PPGPKGPRPPPP 416 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPP 923 P P PPP P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPPP 406 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPPPP P P P P P Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +1 Query: 853 PPXXXPXPPPP----PXPXXPPXP-XPXPPXP 933 PP P PPP P P PP P P PP P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPP---XPXXPPXPXPXPPXP 933 P P P P PPP P PP P P P P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPP P P P P PP Sbjct: 389 PPPAPPPGSGGPKPPP-PPGPKGPRPPPP 416 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPP 923 P P PPP P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPPP 406 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPP PP P P PP Sbjct: 165 PPFAGQGGPPPPYGMRPPYPGPPPP 189 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P P P P PP P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 855 PXXXPGXPPPPPXXXXPXXPPPPP 926 P P PP P P PPPPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG GG GGGGG G GG+ G Sbjct: 121 GGGGYERRSGGYGSGGGGGGRGYGGGGRREG 151 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G GG G GGG G GG G Sbjct: 135 GGGGGGRGYGGG-GRREGGGYGGGDGGSYGG 164 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P PP PP P PP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 769 PPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P L P PP P P PP PP P PP Sbjct: 115 PPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 167 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P PPPP P PPPP Sbjct: 99 PPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPX---PXXPPXPXPXPPXP 933 PP PPPPP P PP P PP P Sbjct: 105 PPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXP---XPPPPPXPXXPPXPXPXPP 927 P PP P PPPPP PP P PP Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPP 121 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPP 927 P PP P PP PPP P P P PP Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P P PPP PPPPP Sbjct: 80 PVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P P P P PPP PPPPP Sbjct: 134 PLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPP--XPXXPPXPXPXPP 927 P PP P PP PP P P P PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP---PXPXXPPXPXPXPPXP 933 P PP PPPP P PP P P P P Sbjct: 120 PPLSPPPPAITPPPPLATTPPALPPKPLPPPLSP 153 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP PPPPP PP P P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 870 GXPPPPPXXXXPXXPPPPP 926 G PPPPP PPPPP Sbjct: 228 GLPPPPPPPPHQAQPPPPP 246 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXP---XPPXP 933 P PPPPP PP P P PP P Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPP 255 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP P PPPPP Sbjct: 230 PPPPPPPPHQAQP--PPPPP 247 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P P PP Sbjct: 230 PPPPPPPPHQAQPPPPPP 247 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP P PPPPP Sbjct: 243 PPPPPSGLFP--PPPPP 257 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.9 bits (69), Expect = 0.63 Identities = 24/76 (31%), Positives = 27/76 (35%), Gaps = 5/76 (6%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPR-----XGXXXGG 768 G GG G G GG G GGG G GG+ G R G GG Sbjct: 104 GGGGRGGGRGG--GSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGG 161 Query: 767 HVXSKWHXXGGXGGXG 720 ++ GG GG G Sbjct: 162 GGGGRYGSGGGGGGGG 177 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G GG G GGG G GG+ G Sbjct: 98 GRGGFGGG-GGRGGGRGGGSYGGGYGGRGSG 127 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGG 875 GGGGG +G GGGGG Sbjct: 161 GGGGGRYGSGGGGGGGG 177 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGG G GGGGG G G G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGG 119 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P P P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPP 87 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPPPX----PXXPPXPXPXPPXP 933 PP PPPPP P PP P PP P Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPP---PPP 926 P F P PPPPP P PP PPP Sbjct: 56 PAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPP 87 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPP--PPPXPXXPPXPXPXPP 927 P PP P PP PPP P P P PP Sbjct: 81 PDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPP PP P PP Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPP 93 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP PPPPP P P PP Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPP 143 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPPP P P PP P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXP-PXPXPXPPXP 933 P P PPPPP P P P PP P Sbjct: 248 PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 25.4 bits (53), Expect(2) = 8.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 874 PPPPPXPXXPP 906 PPPPP P PP Sbjct: 67 PPPPPLPPPPP 77 Score = 25.0 bits (52), Expect(2) = 0.80 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 868 PXPPPPPXPXXP 903 P PPPPP P P Sbjct: 33 PPPPPPPPPVLP 44 Score = 25.0 bits (52), Expect(2) = 0.80 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 877 PPPPXPXXPPXP 912 PPPP P PP P Sbjct: 66 PPPPPPLPPPPP 77 Score = 24.2 bits (50), Expect(2) = 8.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 874 PPPPPXPXXPPXP 912 PPPPP P P P Sbjct: 32 PPPPPPPPPPVLP 44 Score = 22.2 bits (45), Expect(2) = 8.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 901 PPXPXPXPPXP 933 PP P P PP P Sbjct: 66 PPPPPPLPPPP 76 Score = 21.0 bits (42), Expect(2) = 8.3 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 856 PXXXPXPPPPPXP 894 P P PPPP P Sbjct: 32 PPPPPPPPPPVLP 44 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP PP P P P PP P Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSP 71 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPPXP 933 P PPP P PP P PP P Sbjct: 421 PSPPPSPVQPPPPPSPPPQP 440 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPPP P PP P P Sbjct: 364 PPSQFPLPPPPPPP--PPSPSTSSP 386 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP P PP P P PP P Sbjct: 357 PIQFPASPPSQFPLPPPPP-PPPPSP 381 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXP 912 PP P P PPP P PP P Sbjct: 22 PPEKPPSPEPPPSPEPPPSP 41 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P + P P PPP P P P PPP Sbjct: 115 PQLYNPTICPPPPPPYPRQVHPQPPAPPP 143 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGGG G GGGGG G G G Sbjct: 595 GGGGGYGGGGGYGGGGGYGGGYGGASSGG 623 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 GGGGG G GGGGG G Sbjct: 589 GGGGGYGGGGGYGGGGGYGG 608 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGK 849 GG G G GG G G GG GG+ Sbjct: 602 GGGGYGGGGGYGGGYGGASSGGYGGE 627 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PP P PP P PP Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTPP 71 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP P PP P P P Sbjct: 51 PPTQPPTQPPSHPPTQPPTPPPSQSPSQPSP 81 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPP-PPXPXXPPXPXPXPP 927 P PP P PP PP P P P PP Sbjct: 55 PPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPP-XPXPXPPXP 933 P PP P PP P PP P PP P Sbjct: 39 PSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTP 70 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXP 918 P PP P PP P PP P P Sbjct: 47 PPSQPPTQPPTQPPSHPPTQPPTPPP 72 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G GG G GGGGG GG G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/80 (30%), Positives = 25/80 (31%) Frame = -2 Query: 923 GXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXEXXXXXXXXXXGPRXGXXXGGHVXSKWHX 744 G G G GG G G G G G GG G G G + S H Sbjct: 47 GIGIGGGGS-GSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGS--HA 103 Query: 743 XGGXGGXGRRTXGXLSXXGG 684 G GG G S GG Sbjct: 104 GSGSGGRSGSGRGRGSGGGG 123 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPP P P PPPPP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPPP P P P PP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPPPP P P P PP Sbjct: 9 PPPPPPPPPSFRSIPRPPPP 28 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP PPPPP Sbjct: 10 PPPPPPPPSFRSIPRPPPPP 29 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 G GGG WG GGGGG G Sbjct: 65 GEGGGEWGGGGEGGGGGRRG 84 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 925 GGGGGXWGXXXXGG---GGGXPGXXXGXK 848 GGGGG WG GG GGG G G + Sbjct: 55 GGGGGAWGGEGEGGGEWGGGGEGGGGGRR 83 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 GG G G GGGGG G GG+ G Sbjct: 39 GGEWGGAEGGGAWGGGGGGGGAWGGEGEG 67 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPPP P P P PP P Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPPP 244 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXP--XPPXP 933 P P PPPP P P P P PP P Sbjct: 215 PVLLPLQPPPPPPPSQPLPRPLLLPPPP 242 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP----XPPXP 933 PP PPPPP PP P P PP P Sbjct: 153 PPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP 183 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPP----XPXXPPXPXPXPPXP 933 P PP PPPPP P PP PP P Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP 203 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP---XPPXP 933 PP PPPPP P P P PP P Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 >At1g26110.1 68414.m03186 expressed protein Length = 611 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G G GG G GGGGG G GG+ G Sbjct: 576 GYGGRGYGGYGGRGGGGG-GYGYGGRGQG 603 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP P P P P P P Sbjct: 641 PPPMAEMPPPPP-PGEAPPPLPEEPEP 666 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P PPP P P P PP Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXP 924 P PPPPP P P P P Sbjct: 22 PLPPPPPPPMRRSAPSPPP 40 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPP P PPPPP Sbjct: 638 PSPPPPSMSGGAPPPPPPPP 657 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPPP P P P PP Sbjct: 638 PSPPPPSMSGGAPPPPPPPP 657 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXG 854 GGGGG G GGGGG G G Sbjct: 95 GGGGGIGGDKFGGGGGGGDGNDDG 118 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -2 Query: 923 GXGXGXGGXX-GXGGGGGXGXXXGGK 849 G G G GG G GGGGG G GG+ Sbjct: 95 GGGGGIGGDKFGGGGGGGDGNDDGGE 120 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PP PP P PP P P PP Sbjct: 73 PLPPSPP-PTLPPSPPPPPP 91 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PP PP P PPPPP Sbjct: 75 PPSPPPTLPPSPPPPPP 91 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXP 918 S P PP P PPPPP P P P Sbjct: 71 SLPLPPSPPPTLPPSPPPPP-PFSPDLRNP 99 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPP 927 P PPP P PP P P P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P P PP PP P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 763 TWPPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPP---PPXPXXPPXPXPXPP 927 T PP P + P PP PPP PP PP P PP Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPP-PPPXPXXPPXPXPXPPXP 933 P PP P PP P P PP PP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPPP---PPXPXXPPXPXPXPP 927 P PP PPP P P PP P PP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP P P PP PP P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P P P PP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 763 TWPPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPP---PPXPXXPPXPXPXPP 927 T PP P + P PP PPP PP PP P PP Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPP-PPPXPXXPPXPXPXPPXP 933 P PP P PP P P PP PP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPPP---PPXPXXPPXPXPXPP 927 P PP PPP P P PP P PP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANPPPPVSSPP 78 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXGXKXXG 839 GGGGG G GGGGG G G G Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGG 140 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 GGGGG +G GGGGG G Sbjct: 101 GGGGGGYGGGTPGGGGGGGG 120 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP P PP P P P PP P Sbjct: 116 SSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P P P P Sbjct: 114 PVSSPPPESSPPPPPPTEAPPTTPITSPSPP 144 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPP PP P PP Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAPP 110 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXP-XPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P P P PP P Sbjct: 96 PEPSPPPPLPTEAPPPANPVSSPPPESSPPPP 127 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP-PXPXXPPXPXPXPPXP 933 P PP PPP P PP P PP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPPXP 933 PPP P P P P PP P Sbjct: 62 PPPETPLSSPPPEPSPPSP 80 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P PP PPP P P P PP P Sbjct: 69 SSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 878 PPPPXXSXPPXPXPXPP 928 PPPP S P P P PP Sbjct: 147 PPPPPESPPSLPAPDPP 163 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 853 PPXXXPXPPPPPXP 894 P P PPPPP P Sbjct: 280 PSPPPPPPPPPPLP 293 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXP 924 P PPPPP PP P P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLP 107 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP 912 P PP PPPPP P P P Sbjct: 90 PPPPPPIENLPPPPPPLPKFSPSP 113 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXP 869 GGGGG G GGGGG P Sbjct: 123 GGGGGGGGGGGGGGGGGPP 141 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXP 869 GGGGG G GGGGG P Sbjct: 123 GGGGGGGGGGGGGGGGGPP 141 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPPP P P P PP Sbjct: 724 PPPTPTYHYISPPPPPTPIHSPPPQSHPP 752 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXP 924 P PP PPPPP P P P P Sbjct: 747 PQSHPPCIEYSPPPPPTVHYNPPPPPSP 774 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PP P P PP P PP Sbjct: 584 PPFTGPSPPSSPSPPLPPV-IPSPP 607 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP----XPPXP 933 P P PPPPP PP P P PP P Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPP 70 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPP 71 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 141 PPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 157 PPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP P PP P Sbjct: 173 PPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPP PP PP P Sbjct: 38 PPYEYKSPPPPVKSPPPPYEYKSPPPP 64 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P P P P P P P P P Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASP 139 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP PP P PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAP 143 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP PP P PP P Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP PP P PP P Sbjct: 100 PPQSPPASAPTVSPPPV-SPPPAPTSPPPTP 129 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP P PP P P P P Sbjct: 105 PASAPTVSPPPVSPPPAPTSPP-PTPASPPP 134 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 P PP PP PPP P PP P P P P Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPP-PAPASPPP 148 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 P PP PP PPP P PP P P P P Sbjct: 122 PTSPPPTPASPPPAPASPPPAPASPP-PAPVSPPP 155 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP P PP P P P PP P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAP 122 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXPPPP--PXPXXPPXPXPXPPXP 933 P PP PP P P P P P PP P Sbjct: 136 PASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +2 Query: 95 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 223 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +2 Query: 95 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 223 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 868 PXPPPPPXPXXPPXP 912 P PPPPP P PP P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 874 PPPPPXPXXPPXPXP 918 PPPPP P PP P P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPP 927 PPPP P PP P P PP Sbjct: 247 PPPPPP--PPPPPPPPP 261 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 917 GXGXGGXXGXGGGGGXGXXXGGK 849 G G G G GGGGG G GG+ Sbjct: 68 GGGSGNRNGRGGGGGSGGGGGGR 90 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +1 Query: 841 PXXXPPXXXPXPP---PPPXPXXPPXPXPXPP 927 P PP P PP PPP P P P PP Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPPP 900 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 841 PXXXPPXXXPXP-PPPPXPXXPPXPXPXPP 927 P PP P PPPP PP P PP Sbjct: 865 PQSQPPEPPPEMMPPPPQALPPPLPHSHPP 894 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPP 923 P P PPP P P PPPP Sbjct: 873 PPEMMPPPPQALPPPLPHSHPPLVPPPP 900 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXG 854 GGGGG G GGGGG G G Sbjct: 179 GGGGGGCGGSCSGGGGGGGGYGHG 202 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 GGGGG G GGGGG G Sbjct: 167 GGGGGIGGGVIIGGGGGGCG 186 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P PP P Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPP 49 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP PPPPP Sbjct: 28 PLPPPPPPPLMRRRAPPPPP 47 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PPPP P P P PP Sbjct: 44 PPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXP----XXPPXPXPXPPXP 933 P PP PPPP P P P P PP P Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P PP P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPP 35 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +3 Query: 867 PGXPPPPPXXXX--PXXPPPPP 926 P PPPPP P PPPPP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPP 35 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXE 828 GG G GG G G GGG G GG G E Sbjct: 85 GGSNGGFGGRGGDGAGGG-GGGGGGSVDGYYEE 116 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 867 PGXPPPPPXXXXPXXPPPPP 926 P PPPPP P PPPPP Sbjct: 104 PKRPPPPP--PKPQPPPPPP 121 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P P PP P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 917 GXGXGGXXGXGGGGGXGXXXGGKXXG 840 G G GG G GGGGG G GG+ G Sbjct: 59 GGGMGG--GGGGGGGSGGGGGGRGGG 82 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 870 GXPPPPPXXXXPXXPPPPP 926 G PPPPP P PPPPP Sbjct: 68 GFPPPPP---PPLSPPPPP 83 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGG-----GGGXGXXXGGKXXG 840 G GG G GG G GG GGG G GG+ G Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 138 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGG-GGGXGXXXGGKXXG 840 G GG G G G GG GGG G GG G Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXG 854 GGGGG +G GGGG G G Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGG 148 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXP 912 P PP PP PP P PP P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P P PPP PP P P PP P Sbjct: 21 PPPAPPPESSSPPTP-PEPPDP 41 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGK 849 G G G G G G GGGG G GG+ Sbjct: 65 GDGISGGGHGDGLGCSGGGGDGTKGGGR 92 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G GGGGG G GG+ G Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTG 415 >At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 491 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXP 924 PP P PP P P PP P P Sbjct: 58 PPTPPPGPPDSPAPSLPPSPSDDP 81 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP PP P P P Sbjct: 145 PPPVLLSPPPPPVLFSPPPPTVTRPPP 171 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 194 PPPPPYKYGRVYPPPPP 210 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 PP PPPPP PP P PP P Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 PP PPPPP PP P PP P Sbjct: 73 PPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 PP PPPPP PP P PP P Sbjct: 91 PPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP--XPPXP 933 PP PPPPP PP P PP P Sbjct: 127 PPPVLLSPPPPPVNLSPPPPPVLLSPPPP 155 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXP 924 P P PPPP P PP P P P Sbjct: 20 PKNRPPSPPPPLP-LPPSPSPPP 41 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +3 Query: 828 LXXXPXXFXPXXXPGXPP-----PPPXXXXPXXPPPP 923 L P F P P PP PPP P PPPP Sbjct: 283 LPQLPNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPP 319 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G GG G GGG G GG G Sbjct: 71 GGGGGGRGYGGG-GRREGGGYGGGDGGSYGG 100 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP-XPPXP 933 PP PPPP P PP P PP P Sbjct: 221 PPPHGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXP-XPPXP 933 PP PPPP P PP P PP P Sbjct: 221 PPPHGMQGPPPPRPGMPPAPGGFAPPRP 248 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXP 918 P PPPPP PP P P Sbjct: 24 PPPPPPPSSSLPPPPLP 40 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXP 918 P PPPPP PP P P Sbjct: 24 PPPPPPPSSSLPPPPLP 40 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGK 849 G GG GG G GGGGG GG+ Sbjct: 63 GGGGSTGNNGGGSGSGGGGGGFGGSGGE 90 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP PPPPP Sbjct: 24 PPPPPYYYLDPPPPPPP 40 >At3g04460.1 68416.m00473 Pex2/Pex12 N-terminal domain-containing protein similar to SP|O00623 Peroxisome assembly protein 12 (Peroxin-12) (Peroxisome assembly factor-3) (PAF-3) {Homo sapiens}; contains Pfam profile PF04757: Pex2 / Pex12 amino terminal region Length = 393 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPP 927 P P PPPPP P P PP Sbjct: 311 PTVYPPPPPPPAPKMAKEGIPLPP 334 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P PP P PP P Sbjct: 11 PYGQYPYPYPYPAPYRPPSSEPYPPPP 37 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPX-PXPXPP 927 PP P PPPP P P P PP Sbjct: 27 PPSSEPYPPPPTNQYSAPYYPYPPPP 52 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +1 Query: 868 PXPPPPPXPXXP------PXPXPXPP 927 P PPPPP P P P P P PP Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPP 219 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 849 FXPXXXPGXPPPPPXXXXP--XXPPPPP 926 F P P PPPPP PPPPP Sbjct: 40 FLPHPPPPPPPPPPPLYFSYFSLPPPPP 67 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Frame = +1 Query: 868 PXPPPPPXPXXPP-----XPXPXPPXP 933 P PPPPP P PP P PP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPP 68 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P PP P Sbjct: 249 PPLPPPGTAALPPPPPLPMAAGKGVAAPPPP 279 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPPPP P PP P Sbjct: 222 PLPPPPGRAALPPPPPLPMAVRKGVAAPPLP 252 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 25.0 bits (52), Expect(2) = 8.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 868 PXPPPPPXPXXP 903 P PPPPP P P Sbjct: 368 PPPPPPPPPPLP 379 Score = 24.6 bits (51), Expect(2) = 3.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 856 PXXXPXPPPPPXP 894 P P PPPPP P Sbjct: 422 PNSQPRPPPPPPP 434 Score = 23.0 bits (47), Expect(2) = 3.8 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP PP P Sbjct: 429 PPPPPPPQQLQVAGINKTPPPP 450 Score = 21.4 bits (43), Expect(2) = 8.1 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 880 PPPXPXXPPXPXPXPPXP 933 P P P P P PP P Sbjct: 418 PINVPNSQPRPPPPPPPP 435 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G GG G G GG GG G Sbjct: 155 GYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PPXXXPXPP--PPPXPXXPPXPXPXPPXP 933 PP P P PPP P P P PP P Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXP 894 P PP P PPPPP P Sbjct: 76 PSTAPPPPHPPPPPPPLP 93 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PP PP P PP P P Sbjct: 148 PSSPPSPPSPPSPSLPPSSLPPSASP 173 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 841 PXXXPPXXXPXPPP-PPXPXXPPXPXPXPPXP 933 P P PPP PP PP P P P P Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP 85 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 880 PPPXPXXPPXPXPXPPXP 933 PPP P PP P PP P Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PP PP P P P P PP Sbjct: 218 PPKPPSPPRKPPPPPPPP 235 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXP 924 P P PP P PP P P P Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPPXP 933 PPP P P P P PP P Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXGXXXE 828 GG G GG GGGGG GG+ G E Sbjct: 20 GGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDE 52 >At1g62070.1 68414.m07003 expressed protein Length = 121 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P PP P P P Sbjct: 48 PLPLPPPLPTLPPAQLPGLPTP 69 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PPP P PP P P P Sbjct: 26 PRAAPPAR-PTTPPPARPTTPPPVWPTTPPP 55 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 829 SXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 S P P P P PP P P P PP P Sbjct: 113 SDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTP 147 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP P PP P P P PP P Sbjct: 151 PDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 GG G GG G GG GG G GG G Sbjct: 371 GGGGYDMGGVGG-GGAGGYGAGGGGNGGG 398 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGG 852 G GG G G G G GGG G G GG Sbjct: 389 GAGGGGNGGGSFYGGGGGRG-GYGGGG 414 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXP 924 PP P PP P PP P P P Sbjct: 160 PPPHFPPEFPPETPTTPPPPPPRP 183 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPG 866 GGGG WG GGGG G Sbjct: 1296 GGGGSSWGKQNDGGGGSSWG 1315 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGG 875 GGGG WG GGG G Sbjct: 1247 GGGGSSWGKQDGGGGSG 1263 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P PP PP P Sbjct: 197 PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 841 PXXXPPXXXPXPP----PPPXPXXPPXPXPXPPXP 933 P PP P PP PPP P P P P P Sbjct: 310 PVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPP 344 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PP PPP P PP P PP P Sbjct: 58 PMMTPPPMPMTPPPMPMTP-PPMPMAPPPMP 87 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPPXP 933 PP PPPPP P PP P Sbjct: 256 PPYVYSSPPPPPYSPSPKVEFKSPPPP 282 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPP 927 PPPP P PP P PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 877 PPPPXPXXPPXPXPXPP 927 PPPP P PP P PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P PPP P PP P PP P Sbjct: 46 PVYSSPADLP-PPPTPVYSPPPADLPPPPTP 75 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 849 FXPXXXPGXPPPPPXXXXPXXPPPP 923 F P PPPPP P PP P Sbjct: 50 FFPLYSSTSPPPPPSPPQPLPPPAP 74 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGG 852 G GG G GG GGGG GG Sbjct: 85 GGGGRSFGGGGSSSRGGGGSSSRGGGG 111 >At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ boundaries domain protein 11 (LBD11) identical to SP|Q9SK08 LOB domain protein 11 {Arabidopsis thaliana} Length = 229 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXP 912 P PPPPP P PP P Sbjct: 28 PSPTSSPPPPPSPQQPPQP 46 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PP P P PP P PP Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPIYSPP 351 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PP P P PP P PP Sbjct: 457 PVHKPPTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 841 PXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 P PP PP P P PP P PP Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPP 535 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P PPP P PP P P P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHP 176 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 926 GGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 GG G G G G GGGG GG+ G Sbjct: 54 GGGGHGGHGGGGYQGGGGRYQGGGGRQGG 82 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 876 PPPPPXXXXPXXPPPPP 926 PPPPP P PP PP Sbjct: 79 PPPPPPHLLPLSPPLPP 95 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPPXPXPXPP 927 PP P PPPP P P P PP Sbjct: 256 PPPPYPSPPPPSSPLFSPL-LPSPP 279 >At1g13920.1 68414.m01633 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 345 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PPPPPXPXXPPXPXPXPP 927 PPPPP P P P PP Sbjct: 204 PPPPPPPLLSPSPLRLPP 221 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGG----GGGXGXXXGGK 849 G GG G G GG G G GGG G GG+ Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQ 78 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 853 PPXXXPXPPPPPXPXXPP 906 PP P PPPPP PP Sbjct: 26 PPKSPPPPPPPPALPKPP 43 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGG 852 G GG G GG G GGG G GG Sbjct: 637 GGGGRGNRFGGGGGNRFGGGGGRGRGG 663 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 911 GXGGXXGXGGGGGXGXXXGGK 849 G GG G G GGG G GG+ Sbjct: 8 GGGGGGGGGSGGGIGGGGGGR 28 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 922 GGGGXWGXXXXGGGGGXPGXXXG 854 GGGG G GGGGG G G Sbjct: 127 GGGGQGGGGQGGGGGGAEGGTTG 149 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P PPPPP P P P P P Sbjct: 129 PHHRHHPPPPPPPPPPRSPNSASPPP 154 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +1 Query: 841 PXXXPPXXXPXP--PPPPXPXXPPXPXPXPPXP 933 P PP P P PPP PP P P P Sbjct: 28 PTATPPPATPPPVATPPPVATPPPAATPAPATP 60 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P F P P PPP PPPPP Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P F P P PPP PPPPP Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 840 PXXFXPXXXPGXPPPPPXXXXPXXPPPPP 926 P F P P PPP PPPPP Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 932 GXGGXGXGXGGXXGXGGGGGXGXXXGGKXXG 840 G GG G G G GG G G GG+ G Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGG 37 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 868 PXPPPPPXPXXPPXPXPXP 924 P PPPPP P P P P Sbjct: 4 PSPPPPPIPESRPRPLTPP 22 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 856 PXXXPXPPPPPXPXXPPXPXPXPPXP 933 P P P P P P P P P P P Sbjct: 38 PVPSPKPKPVPSPKPKPVPSPSVPSP 63 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 925 GGGGGXWGXXXXGGGGGXPGXXXG 854 GGGGG G GGGG G G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGG 35 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 917 GXGXGGXXGXGGGGGXGXXXGG 852 G GG G GGGGG G GG Sbjct: 91 GIVVGGGGGGGGGGGGGGGSGG 112 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 922 GGGGXWGXXXXGGGGGXPGXXXG 854 GGGG G GGGGG G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSG 213 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +1 Query: 763 TWPPXXXPXLGXXXXXXXXXXXSXXXPXXXPPXXXPXPPPPPXPXXPPXPXPXPP 927 T PP P P PP P PP P PP P P Sbjct: 136 TKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKP 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,200,949 Number of Sequences: 28952 Number of extensions: 386427 Number of successful extensions: 15506 Number of sequences better than 10.0: 183 Number of HSP's better than 10.0 without gapping: 1555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7176 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2227127592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -