BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C18 (980 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49134| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.9 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 30 2.5 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 5.8 SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) 29 5.8 SB_6643| Best HMM Match : Antimicrobial_8 (HMM E-Value=0.27) 29 7.6 >SB_49134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +2 Query: 353 FSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQXNVLIRLLHSYYPAL*HRQ 532 F++ YE RE A++ FK+ + + Y+ + Q N IR+ Y PA HR+ Sbjct: 725 FALHYEGSRESAVSAFKMGKSRAEIQRAYRERKKGKDSNWQQNESIRVQKYYTPASKHRR 784 Query: 533 LRS 541 L+S Sbjct: 785 LKS 787 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 816 PPPXXSPAXGGTPGXXXXPSXATPXGXXXF-XXXPPNXXXPXPPGG 950 PPP P G P P P G PP P PPGG Sbjct: 242 PPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGG 287 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 804 LSXXPPPXXS-PAXGGTPGXXXXPSXATP-XGXXXFXXXPPNXXXPXPPGG 950 +S PPP P GG PG P P G PP PPGG Sbjct: 153 MSEPPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGG 203 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PPPXXSPAXGGTP--GXXXXPSXATPXGXXXFXXXPPNXXXPXPP 944 PPP +P GG P G P + P G P P PP Sbjct: 70 PPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPP 114 >SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 670 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = +1 Query: 256 QHRGQQGLLHKHESLRKFHDDVQGRIPSQEFGILDLLRKNEGRSHRAVQAVLLCQRF*MF 435 Q G G + + E + K D+QG++PS + D+ R + S AV+L Q F Sbjct: 208 QTAGDSGGISREEFITKIASDIQGKLPS----LFDVDRVRKNLSEITPTAVVLLQELDRF 263 Query: 436 LQNSMLRQ 459 N ++R+ Sbjct: 264 --NVLIRR 269 >SB_6643| Best HMM Match : Antimicrobial_8 (HMM E-Value=0.27) Length = 251 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 316 DVQGRIPSQEFGILDLLR-KNEGRSHRAVQAVLLCQRF*MFLQNSMLRQSL 465 D G + S I + R K+ GR+HRA VL+ Q M ++ ++ QSL Sbjct: 192 DFFGGVVSDSDRISRITRIKHHGRAHRAGDEVLVLQMMVMSIKMKLINQSL 242 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,880,141 Number of Sequences: 59808 Number of extensions: 405843 Number of successful extensions: 880 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -