BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C11 (921 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 2.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 2.2 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 23 3.0 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 5.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 6.8 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 9.0 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.8 bits (49), Expect = 2.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 697 GNYSGVFLALISLLCMFNIP 638 G+YS V L + +LL +F+IP Sbjct: 76 GSYSSVSLQVANLLRLFHIP 95 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.8 bits (49), Expect = 2.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 697 GNYSGVFLALISLLCMFNIP 638 G+YS V L + +LL +F+IP Sbjct: 166 GSYSSVSLQVANLLRLFHIP 185 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 23.4 bits (48), Expect = 3.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 326 QKAHSAYPKFQPLVLQWSFHYPFHI 252 ++ Y +FQ L L+ FHY ++ Sbjct: 9 RRGRQTYTRFQTLELEKEFHYNHYL 33 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.6 bits (46), Expect = 5.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 213 VWNSISTFLIKLLNMERIMEAPLKNKWL 296 +W+ ST++ K+ N + + L+N WL Sbjct: 318 IWDYDSTYIPKVKNKKAGSKHLLQNTWL 345 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 6.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 289 LFFNGASIILSIFNSFIKNVLILFHTS 209 LF N AS+ + IFN I +L++ H S Sbjct: 268 LFLNMASVFMRIFN-LICMMLLIGHWS 293 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 6.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 345 IFNISHPKSTLSISKVSATCSSMELPLS 262 ++ ISHPK L + K E P+S Sbjct: 327 VYAISHPKYRLELQKRLPWLELQEKPIS 354 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 9.0 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 349 NNF*YFTPKKHTQHIQSFSHLFFNGASIILSI-FNSFI 239 +NF TP++ Q I S + F A II +I + SFI Sbjct: 430 HNFTTMTPQEIAQWIDRRSRIVFPVAFIIFNILYWSFI 467 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,952 Number of Sequences: 438 Number of extensions: 5255 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29992872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -