BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C07 (924 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 26 1.9 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 26 1.9 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 26 1.9 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.8 bits (54), Expect = 1.9 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 30 ILKICFSXHASFGARVLIVLSSILQAKMDKPNVLARVVKVLGRTG 164 I KIC S S AR ++ +S+ MD+P +L +V V G TG Sbjct: 370 IKKICDSFAVSPIAREVLETASVAGKGMDEPYMLQQVEGV-GSTG 413 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.8 bits (54), Expect = 1.9 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 30 ILKICFSXHASFGARVLIVLSSILQAKMDKPNVLARVVKVLGRTG 164 I KIC S S AR ++ +S+ MD+P +L +V V G TG Sbjct: 370 IKKICDSFAVSPIAREVLETASVAGKGMDEPYMLQQVEGV-GSTG 413 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 25.8 bits (54), Expect = 1.9 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 30 ILKICFSXHASFGARVLIVLSSILQAKMDKPNVLARVVKVLGRTG 164 I KIC S S AR ++ +S+ MD+P +L +V V G TG Sbjct: 348 IKKICDSFAVSPIAREVLETASVAGKGMDEPYMLQQVEGV-GSTG 391 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,800 Number of Sequences: 2352 Number of extensions: 8826 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100468593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -