BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C07 (924 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024776-21|AAK68479.1| 65|Caenorhabditis elegans Ribosomal pr... 81 1e-15 Z81129-4|CAB03405.1| 330|Caenorhabditis elegans Hypothetical pr... 29 3.6 >AC024776-21|AAK68479.1| 65|Caenorhabditis elegans Ribosomal protein, small subunitprotein 28 protein. Length = 65 Score = 80.6 bits (190), Expect = 1e-15 Identities = 41/54 (75%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = +3 Query: 111 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG-ETSRQIIRNVKGPVRDGDILT 269 MDK LARV KV+GRTGSQGQCTQV+VEFI + +R IIRNVKGPVR+GDILT Sbjct: 1 MDKLT-LARVTKVIGRTGSQGQCTQVRVEFINDQNNRSIIRNVKGPVREGDILT 53 >Z81129-4|CAB03405.1| 330|Caenorhabditis elegans Hypothetical protein T23F1.6 protein. Length = 330 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 53 TRQLWCTCVNCIKLDITSQNG*TQRSCSCREST 151 TRQ C C ++ + Q Q SCSC+ ST Sbjct: 23 TRQASCGCAQSVQPTCSCQQASQQYSCSCQPST 55 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,902,672 Number of Sequences: 27780 Number of extensions: 189189 Number of successful extensions: 406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2370744068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -