BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C06 (991 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) iden... 83 3e-16 At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) 80 2e-15 At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) 77 1e-14 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 54 1e-07 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 54 2e-07 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 49 6e-06 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 48 1e-05 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 47 2e-05 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 46 3e-05 At1g61080.1 68414.m06877 proline-rich family protein 46 5e-05 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 45 7e-05 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 45 7e-05 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 45 9e-05 At1g26150.1 68414.m03192 protein kinase family protein similar t... 45 9e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 44 1e-04 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 44 2e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 44 2e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 44 2e-04 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 44 2e-04 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 44 2e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 44 2e-04 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 44 2e-04 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 43 3e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 43 4e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 42 6e-04 At4g01985.1 68417.m00265 expressed protein 42 6e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 41 0.001 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 41 0.001 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 40 0.002 At5g46730.1 68418.m05757 glycine-rich protein 40 0.002 At3g51290.1 68416.m05614 proline-rich family protein 40 0.002 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.002 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.002 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 39 0.004 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 39 0.004 At2g30560.1 68415.m03722 glycine-rich protein 39 0.004 At1g27710.1 68414.m03387 glycine-rich protein 39 0.004 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 39 0.004 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 39 0.006 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 39 0.006 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 39 0.006 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 38 0.008 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 38 0.008 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 38 0.010 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 38 0.010 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 38 0.014 At3g50180.1 68416.m05486 hypothetical protein 38 0.014 At2g05440.2 68415.m00575 glycine-rich protein 38 0.014 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 37 0.018 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 37 0.018 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 37 0.024 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 37 0.024 At1g10620.1 68414.m01204 protein kinase family protein contains ... 37 0.024 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 36 0.031 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.031 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.031 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.031 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.031 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.042 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 35 0.047 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 36 0.055 At5g38560.1 68418.m04662 protein kinase family protein contains ... 36 0.055 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 36 0.055 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 36 0.055 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 36 0.055 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 35 0.073 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 35 0.073 At2g05440.1 68415.m00574 glycine-rich protein 35 0.073 At1g04800.1 68414.m00476 glycine-rich protein 35 0.073 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 35 0.096 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 35 0.096 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 35 0.096 At4g18570.1 68417.m02749 proline-rich family protein common fami... 35 0.096 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 35 0.096 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 35 0.096 At3g24540.1 68416.m03082 protein kinase family protein contains ... 35 0.096 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 35 0.096 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 34 0.13 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 34 0.13 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 34 0.17 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 34 0.17 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 0.18 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.22 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.22 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.22 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 33 0.22 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 33 0.22 At1g75550.1 68414.m08780 glycine-rich protein 33 0.22 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 33 0.22 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 33 0.29 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 33 0.29 At1g70990.1 68414.m08190 proline-rich family protein 33 0.29 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 33 0.29 At1g15830.1 68414.m01900 expressed protein 33 0.29 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.39 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 33 0.39 At3g13140.1 68416.m01644 hydroxyproline-rich glycoprotein family... 33 0.39 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.39 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.39 At1g02710.1 68414.m00222 glycine-rich protein 33 0.39 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 27 0.41 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 30 0.46 At3g55950.1 68416.m06217 protein kinase family protein contains ... 28 0.51 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 32 0.51 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 32 0.51 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 32 0.51 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 32 0.51 At1g77030.1 68414.m08970 glycine-rich protein 32 0.51 At1g62240.1 68414.m07021 expressed protein 32 0.51 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 32 0.51 At1g29380.1 68414.m03592 hypothetical protein 32 0.51 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 32 0.51 At1g15840.1 68414.m01901 expressed protein 32 0.51 At1g04660.1 68414.m00463 glycine-rich protein 32 0.51 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.68 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 32 0.68 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 32 0.68 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 32 0.68 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 32 0.68 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 32 0.68 At3g24550.1 68416.m03083 protein kinase family protein contains ... 32 0.68 At1g11850.1 68414.m01363 expressed protein 32 0.68 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 0.90 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 31 0.90 At5g10060.1 68418.m01165 expressed protein 31 0.90 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 31 0.90 At1g53625.1 68414.m06096 expressed protein 31 0.90 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.90 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.2 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 1.2 At4g30460.1 68417.m04325 glycine-rich protein 31 1.2 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 1.2 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 31 1.2 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 31 1.2 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 31 1.2 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 31 1.2 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 29 1.4 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 31 1.6 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 31 1.6 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 31 1.6 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 1.6 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 31 1.6 At4g33660.1 68417.m04781 expressed protein 31 1.6 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 31 1.6 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 31 1.6 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 1.6 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 1.6 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 31 1.6 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 25 1.6 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 25 1.6 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 30 2.1 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 30 2.1 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 30 2.1 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 30 2.1 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 30 2.1 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 30 2.1 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 30 2.1 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 30 2.1 At2g11005.1 68415.m01177 glycine-rich protein 30 2.1 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 30 2.1 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 30 2.1 At1g11850.2 68414.m01364 expressed protein 30 2.1 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.1 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 30 2.6 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 30 2.7 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 30 2.7 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 30 2.7 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 30 2.7 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 2.7 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 30 2.7 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 30 2.7 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 30 2.7 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.7 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 30 2.7 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 30 2.7 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 2.7 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 30 2.7 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 3.6 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 3.6 At5g01170.1 68418.m00021 glycine-rich protein predicted proteins... 29 3.6 At4g34440.1 68417.m04894 protein kinase family protein contains ... 29 3.6 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 3.6 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 3.6 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 3.6 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 3.6 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 3.6 At1g55270.1 68414.m06314 kelch repeat-containing F-box family pr... 29 3.6 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 3.6 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 29 3.6 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 25 4.0 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 25 4.1 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 29 4.8 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 4.8 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 29 4.8 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 29 4.8 At4g08230.1 68417.m01358 glycine-rich protein 29 4.8 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 29 4.8 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 4.8 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 4.8 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family... 29 4.8 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 4.8 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 4.8 At1g26110.1 68414.m03186 expressed protein 29 4.8 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 4.8 At4g21720.1 68417.m03145 expressed protein 25 4.8 At5g25220.1 68418.m02990 homeobox protein knotted-1 like 3 (KNAT... 26 5.6 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 6.3 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 29 6.3 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 6.3 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 6.3 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 29 6.3 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 29 6.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 6.3 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 29 6.3 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 6.3 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 6.3 At2g05510.1 68415.m00583 glycine-rich protein 29 6.3 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 6.3 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 29 6.3 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 29 6.3 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 6.3 At3g28630.1 68416.m03573 expressed protein contains Pfam profil... 24 7.4 At3g28630.2 68416.m03574 expressed protein contains Pfam profil... 24 7.4 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 25 7.7 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 28 8.3 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 28 8.3 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 8.3 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 28 8.3 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 28 8.3 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 28 8.3 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 28 8.3 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 28 8.3 At1g07135.1 68414.m00759 glycine-rich protein 28 8.3 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 25 9.6 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 25 10.0 >At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) identical to cDNA ribosomal protein S27 (ARS27A) GI:4193381 Length = 86 Score = 83.0 bits (196), Expect = 3e-16 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 211 CYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFRRK 339 C+ ITTVFSH+Q VVVC C TILCQPTGG+A+LTEGCSFRRK Sbjct: 42 CFNITTVFSHSQTVVVCGNCQTILCQPTGGKAKLTEGCSFRRK 84 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 105 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPG 209 IDLL+P E+RKHKLKRLV PNS+FMDVKC G Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQG 41 >At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) Length = 84 Score = 80.2 bits (189), Expect = 2e-15 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +1 Query: 211 CYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFRRK 339 C+ ITTVFSH+Q VVVC C T+LCQPTGG+ARL EGCSFR+K Sbjct: 42 CFNITTVFSHSQTVVVCGNCQTVLCQPTGGKARLQEGCSFRKK 84 Score = 62.9 bits (146), Expect = 3e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 105 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPG 209 IDLLHP P E+RKHKLKRLV PNS+FMDVKC G Sbjct: 7 IDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQG 41 >At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) Length = 84 Score = 77.4 bits (182), Expect = 1e-14 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +1 Query: 211 CYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFRRK 339 C+ ITTVFSH+Q VV+C C T+LC PTGG+A+LTEGCSFR+K Sbjct: 42 CFNITTVFSHSQTVVMCGNCQTLLCTPTGGKAKLTEGCSFRKK 84 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 105 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPG 209 IDLL+P E+RKHKLKRLV PNS+FMDVKC G Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQG 41 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 54.0 bits (124), Expect = 1e-07 Identities = 31/98 (31%), Positives = 32/98 (32%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP-RHXXPPXSX 873 PPPPP PP V PPPPPPP PPP PP + PP Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPV 517 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PPS P P P P Sbjct: 518 YSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555 Score = 53.6 bits (123), Expect = 2e-07 Identities = 29/97 (29%), Positives = 30/97 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P P+ P V PPPPPPP PPP PP P Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPS 486 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P P P P P Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/101 (29%), Positives = 33/101 (32%), Gaps = 4/101 (3%) Frame = +1 Query: 697 PPPPPXXPLX--PPXXXXXL--AXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP 864 P PPP P+ PP + + PPPPPPP PPP PP PP Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPP 467 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P P P P P Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 49.6 bits (113), Expect = 3e-06 Identities = 28/96 (29%), Positives = 31/96 (32%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P+ P + PPPPPP PPP PP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPP--PCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYY 648 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP +P P S P P P P Sbjct: 649 SSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPP 684 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/97 (28%), Positives = 28/97 (28%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PP PP PP PPPPPP PPP PP PP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P P P S P P P P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/102 (30%), Positives = 32/102 (31%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP PPPPP P PP PP H PP Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSS-----PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFS 551 Query: 877 XSXPXP-----PSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P P +P P S P P P P Sbjct: 552 PPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPP 593 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/102 (29%), Positives = 30/102 (29%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP-----XPPRHXXP 861 P PPP P PP PP PPPP PPP PP P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPT--LTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP P P P P P P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/99 (27%), Positives = 29/99 (29%), Gaps = 2/99 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP--PPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP P P PPPP PP PPP P PP + Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPT 604 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP + P P P P P Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP 643 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/97 (27%), Positives = 30/97 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP + PPPPP PPP P + PP Sbjct: 512 PPPPPVYSSPPPPPSPA---PTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHS 568 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P P P S P P + P P Sbjct: 569 SPPPHSPPPPHSPPPPIYP--YLSPPPPPTPVSSPPP 603 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/95 (26%), Positives = 28/95 (29%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXS 882 PPP PP + PPPPPP PPP PP S Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSS 660 Query: 883 XPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP +P P+P P P Sbjct: 661 PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP PPPPP PPP P H PP Sbjct: 662 PPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEES--PPPAPVVHHSPPPPMV 719 Query: 877 XSXPXPP 897 P PP Sbjct: 720 HHSPPPP 726 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/95 (28%), Positives = 29/95 (30%), Gaps = 7/95 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-------PPXXXXXXXXPPPXPPRHX 855 PPPP PP + PPPPP PP PPP P H Sbjct: 663 PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPP-PMVHH 721 Query: 856 XPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP P PPS P + P P Sbjct: 722 SPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPP 756 Score = 38.3 bits (85), Expect = 0.008 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS-X 873 PPPPP P PPPPP PPP H PP Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP-VHYSSPPPPEVHYHSPPPSPVH 688 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PPS P S P P P P Sbjct: 689 YSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPP 726 Score = 37.9 bits (84), Expect = 0.010 Identities = 29/106 (27%), Positives = 32/106 (30%), Gaps = 9/106 (8%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP------PPPPXXXXXXXXPPPXPPR 849 PPPPP P PP PPP PPP PPP P Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPC 700 Query: 850 HXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + PP + +P P S P P P P Sbjct: 701 EESPPPAPVVHHSPPPPMVHHSP--PPPVIHQSPPPPSPEYEGPLP 744 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PP P PPP P PP P PP + P P P P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Query: 967 XLXXPRP 987 P P Sbjct: 456 PPPPPPP 462 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/93 (32%), Positives = 32/93 (34%) Frame = +1 Query: 682 SXXGXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP 861 S PPPPP P PP PPPPPPP PPP PP + P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPP--------PPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P PPS P P+P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXA-PXXXXPXXXXSXPAP 960 PPPPPPP PPP PP PP P PPS P P P+P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Query: 961 XAXLXXPRP 987 P P Sbjct: 441 PYVYPPPPP 449 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPPPP PPP PP PP S P PP P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Query: 964 AXLXXPRP 987 P P Sbjct: 440 PPYVYPPP 447 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXS 948 F P PPPPP PPP PP PP P PP P P Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP----PPPPSPPPYVYPP 427 Query: 949 XPAPXAXLXXPRP 987 P P P P Sbjct: 428 PPPPYVYPPPPSP 440 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXP---PXPPPXSPPXXXXXXXXXSXXXX 955 PP PPPP PP P PP P PPP SPP Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 Query: 956 HPXP 967 +P P Sbjct: 456 YPSP 459 Score = 35.9 bits (79), Expect = 0.042 Identities = 22/72 (30%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXX---FXXXXPPPP---PPPXXXXXXXXPPPXPPRHXX 858 PPPPP P PP + PPPP PPP PPP P+ Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 Query: 859 PPXSXXXSXPXP 894 P P P Sbjct: 456 YPSPPCNDLPTP 467 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 777 PXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXAPXXXAXRFXXX 956 P PPP PPP P P P PP P PS P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 957 TPXPPXXXAP 986 P PP P Sbjct: 437 PPSPPYVYPP 446 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPP P PPP PP PP S P PPS +P P S P P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP-PPPPVHHSSPPPPS 470 Query: 964 AXLXXPRP 987 P P Sbjct: 471 PEFEGPLP 478 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRH-XXPPXSX 873 PPPPP PL PP + V P PPP PPP P H PP S Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Query: 874 XXSXPXPP 897 P PP Sbjct: 472 EFEGPLPP 479 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/67 (34%), Positives = 24/67 (35%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PPPPPP PP PP PP S P PPS +P S P P Sbjct: 411 PPPPPPS--------PPLPPPVYSPPPSPPVFSP-PPSPPVYSPPPPPSIHYSSPPPPPV 461 Query: 967 XLXXPRP 987 P P Sbjct: 462 HHSSPPP 468 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/101 (29%), Positives = 34/101 (33%), Gaps = 4/101 (3%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP P P PP L + PPPPP P PP PP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Query: 868 SXXXSXPXPPSXLXXAPXXXXP-XXXXSXPAPXAXLXXPRP 987 + + P PPS +P P S P P A P P Sbjct: 763 TVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 Score = 39.9 bits (89), Expect = 0.003 Identities = 33/112 (29%), Positives = 38/112 (33%), Gaps = 15/112 (13%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXX-LAXXVXXFXXXXPPP-----------PPPPXXXXXXXXPPPX 840 PPPPP L PP ++ PPP PPPP PPP Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPT--VHYNPPPPP 772 Query: 841 PPRHXXPPXS---XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P H PP S + P PP + +P P S P P P P Sbjct: 773 SPAHYSPPPSPPVYYYNSPPPPPAVHYSP-PPPPVIHHSQPPPPPIYEGPLP 823 Score = 34.7 bits (76), Expect = 0.096 Identities = 22/88 (25%), Positives = 25/88 (28%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP PPP P PPP + PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYS----------PPPSPPVYYYNSPPPPPAVHYSPPPPPVI 807 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP + P P + P P Sbjct: 808 HHSQPPPPPIYEGPLPPIPGISYASPPP 835 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/62 (30%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXS---XXXSXPXPPSXLXXAPXXXXPXXXXSXP 954 PPPP P PP PP + PP + S P PP+ + P P P Sbjct: 702 PPPPAP---YYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSP 758 Query: 955 AP 960 P Sbjct: 759 PP 760 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPP-PXSP 910 P PP P T P P PP P PP P SP Sbjct: 534 PSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/99 (33%), Positives = 34/99 (34%), Gaps = 4/99 (4%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPPXS 870 PPP L PP L+ PPPP PPP PPP P PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLS--PPPPPVNLSPPPPP 111 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP L P P S P P L P P Sbjct: 112 VNLSPPPPPVLLSPPP----PPVLLSPPPPPVNLSPPPP 146 Score = 46.8 bits (106), Expect = 2e-05 Identities = 33/100 (33%), Positives = 34/100 (34%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP L PP L+ PPPP PPP PPP P PP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLS--PPPPPVLLSPPPP 137 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP L P P S P P P P Sbjct: 138 PVNLSPPPPPVLLSPPP----PPVLFSPPPPTVTRPPPPP 173 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/97 (29%), Positives = 31/97 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P P P L PP ++ PPPP PPP P PP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPP-------VNLSPPPPPVNLSPPPPPVN 86 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP L P P S P P L P P Sbjct: 87 LSPPPPPVLLSPPP----PPVNLSPPPPPVNLSPPPP 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/82 (31%), Positives = 31/82 (37%), Gaps = 4/82 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP L PP L+ PPPP PPP PPP P PP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLS--PPPPPVLFSPPPP 164 Query: 868 SXXXSXPXPPSXLXXAPXXXXP 933 + + P PP + +P P Sbjct: 165 TV--TRPPPPPTITRSPPPPRP 184 Score = 37.1 bits (82), Expect = 0.018 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPP 864 PPPPP L PP L+ PPPP PPP PPP PP Sbjct: 116 PPPPPVL-LSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP--PPVLFSPPPPTVTRPPPP 172 Query: 865 XSXXXSXPXP 894 + S P P Sbjct: 173 PTITRSPPPP 182 Score = 37.1 bits (82), Expect = 0.018 Identities = 23/67 (34%), Positives = 24/67 (35%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP A PPPPP PPP PP+ S Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKK------TPPPPPYKYGRVYPPPPPPPQ---AARSYK 219 Query: 877 XSXPXPP 897 S P PP Sbjct: 220 RSPPPPP 226 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPPPXP 843 PPPP L PP L+ PPP PPP PPP P Sbjct: 135 PPPPVN--LSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PP PP T P P P PPP P Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 697 PPPPPXX--PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP 837 PPPPP + PP A PPPPPP PPP Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYK---RSPPPPPPSKYGRVYSPPPP 239 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/99 (28%), Positives = 32/99 (32%), Gaps = 2/99 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP--PPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPPP PP ++ V + P PPPP P PPP P PP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP---SPPPP 559 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P P+P P P Sbjct: 560 YIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSP 598 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/96 (26%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP V PPPPP PPP PP + P Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPP 691 Query: 880 SXP--XPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P PP P P P + + P Sbjct: 692 PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYP 727 Score = 37.1 bits (82), Expect = 0.018 Identities = 28/94 (29%), Positives = 31/94 (32%), Gaps = 15/94 (15%) Frame = +1 Query: 682 SXXGXPPPP-----PXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPP-----XXXX 816 S PPPP P PP ++ V + PPP PPPP Sbjct: 466 SFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVR 525 Query: 817 XXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPP P PP S P PPS P Sbjct: 526 AYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 35.9 bits (79), Expect = 0.042 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = +1 Query: 697 PPPPPXXPLX-PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSX 873 P P P PP + + PPPPPP PPP PP + PP + Sbjct: 587 PSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVY-YPPVT- 644 Query: 874 XXSXPXPP 897 S P PP Sbjct: 645 -ASPPPPP 651 Score = 35.1 bits (77), Expect = 0.073 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXP--PXPPXPPP 901 PP PPP P + R P P P P PP PPP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP 542 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXS 882 PPP PP V PPPP P PP P PP + Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVT---Q 746 Query: 883 XPXPPS 900 P PPS Sbjct: 747 SPPPPS 752 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/77 (27%), Positives = 22/77 (28%), Gaps = 5/77 (6%) Frame = +1 Query: 682 SXXGXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPP 846 S PPPPP P P + PPP PPP PP P Sbjct: 523 SVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPK 582 Query: 847 RHXXPPXSXXXSXPXPP 897 P P PP Sbjct: 583 YEQTPSPREYYPSPSPP 599 Score = 31.5 bits (68), Expect = 0.90 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXP-PRHXXPPXSX 873 PPPPP L + PPPP P PPP P PP S Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASP 763 Query: 874 XXSXP 888 S P Sbjct: 764 NQSPP 768 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/98 (24%), Positives = 27/98 (27%), Gaps = 2/98 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXL--AXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSX 873 PPPP + P + + PPPP PPP PP P Sbjct: 456 PPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPP-PEYEPSPP 514 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S PS P S P P P P Sbjct: 515 PPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPP PP P P + P PPS P S +P Sbjct: 440 PPPPPSSKMSPTFRATPPPPSSKMSP---SFRATPPPPSSKMSPSFRATPPPPSSKMSPS 496 Query: 964 AXLXXPRP 987 P P Sbjct: 497 VKAYPPPP 504 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/90 (30%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +1 Query: 697 PPPPPXXPLX--PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP PL P L V PPPP PP PP PP P Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTI 520 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP AP P + P Sbjct: 521 AAPPPPPPPPRAAVAPPPPPPPPGTAAAPP 550 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 8/105 (7%) Frame = +1 Query: 697 PPPPPXX-------PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHX 855 PPPPP PL P +A PPPPPPP PP PP Sbjct: 422 PPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Query: 856 XPPXSXXXSXPXPPSXLXXAP-XXXXPXXXXSXPAPXAXLXXPRP 987 P PP+ P P P P P P Sbjct: 482 PAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPP 526 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/88 (28%), Positives = 27/88 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP + PP PPPPPPP PPP PP P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAA------PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S P P + P P Sbjct: 580 MPMGNSGSGGPPPPPPPMPLANGATPPP 607 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/88 (28%), Positives = 27/88 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P PP PL + PPPPPPP PPP P PP Sbjct: 495 PTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP-- 552 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P P P+P Sbjct: 553 ---PPPPGTQAAPPPPPPPPMQNRAPSP 577 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/79 (29%), Positives = 27/79 (34%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P+ + PPPPPPP PPP PP + Sbjct: 562 PPPPPPPPMQNRAPSPP-PMPMGNSGSGGPPPPPPPMPLANGATPPPPPP--PMAMANGA 618 Query: 877 XSXPXPPSXLXXAPXXXXP 933 P PP + A P Sbjct: 619 AGPPPPPPRMGMANGAAGP 637 Score = 38.3 bits (85), Expect = 0.008 Identities = 28/95 (29%), Positives = 29/95 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP A PPP PP PPP PP Sbjct: 416 PPPPPPPP-PPPLSFIKTA----SLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLK 470 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P PP L P P + P P P Sbjct: 471 HFAPPPPPPL---PPAVMPLKHFAPPPPTPPAFKP 502 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/91 (28%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP---PPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPPP P P PPPPPP PP PP PP Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPP---PPPR 531 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 + P PP A P + AP Sbjct: 532 AAVAPPPPPPPPGTAAAPPPPPPPPGTQAAP 562 Score = 35.9 bits (79), Expect = 0.042 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPP-----XPPPXSPP 913 PP PPPP P R P PP PP PPP PP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 35.9 bits (79), Expect = 0.042 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +1 Query: 691 GXPPPPPXXPLX----PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 G PPPPP PL PP +A PPPPPP PP PP Sbjct: 589 GPPPPPPPMPLANGATPPPPPPPMAMANGA---AGPPPPPPRMGMANGAAGPPPPP 641 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXP---PXPPPXSPP 913 PP PPPP T P P PP P PPP PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 34.7 bits (76), Expect = 0.096 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 682 SXXGXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPR 849 S G PPPPP PP A PPPPPP PPP PPR Sbjct: 585 SGSGGPPPPP-----PPMPLANGA--------TPPPPPPPMAMANGAAGPPPPPPR 627 Score = 32.3 bits (70), Expect = 0.51 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P P PPPP PP PP PP + Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPP---PPPGTAAA 548 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP A P AP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAP 575 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PPPP T+ P PP PP P P S P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAP---PPPPPPPMQNRAPSPPPMPMGNSGSGGPPP 592 Query: 965 PXXP 976 P P Sbjct: 593 PPPP 596 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/78 (25%), Positives = 22/78 (28%), Gaps = 2/78 (2%) Frame = +3 Query: 744 PPXXXXXXLPXPX--PPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRX 917 PP +P PPP PP F + P P P PP P P Sbjct: 477 PPPLPPAVMPLKHFAPPPPTPPAFKPLK--GSAPPPPPPPPLPTTIAAPPPPPPPPRAAV 534 Query: 918 XAPXXXAXRFXXXTPXPP 971 P P PP Sbjct: 535 APPPPPPPPGTAAAPPPP 552 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G GG GG GGG K GGGGGG K GG +G Sbjct: 328 GGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGG-PNGNKGGGGVQMNGGPNGGKKG 386 Query: 716 XXGGGGG 696 GGGGG Sbjct: 387 GGGGGGG 393 Score = 35.5 bits (78), Expect = 0.055 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G GG GG GG K GGGGGGG GG Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGG------KKGGGGGGGGGGGPMSGGLPPGFRPMGG--- 411 Query: 716 XXGGGGGXP 690 GGGGG P Sbjct: 412 -GGGGGGGP 419 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG GGG G G G GG GG GG G P G G G Sbjct: 386 GGGGGGGGGGGPMSGGLPPGFRPMGGGGG--GGGGPQSMSMPMGGAMGGPMGSLPQMGGG 443 Query: 622 XGXRS 608 G S Sbjct: 444 PGPMS 448 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 803 GGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGGXP 690 G GGGGG + GG G GGGGG P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXP 677 GGG GGG GG GG GG GG G + P Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPKMVIP 146 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = -3 Query: 845 GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 G GGG + GGGG G + GG G GGGG Sbjct: 325 GPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Score = 30.3 bits (65), Expect = 2.1 Identities = 30/125 (24%), Positives = 34/125 (27%), Gaps = 1/125 (0%) Frame = -1 Query: 967 GXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXX-GGGX 791 G G+ + G G G GG G G GGG Sbjct: 303 GKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGG 362 Query: 790 GGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXGXR 611 GG G G G +GG GG G P PG G G G + Sbjct: 363 GGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPM--SGGLPPGFRPMGGGGGGGGGPQ 420 Query: 610 SGXPP 596 S P Sbjct: 421 SMSMP 425 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 803 GGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG GGGG + GG G GGGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG G G GG G + GG GGGG GG Sbjct: 350 GGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGG 392 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 45.2 bits (102), Expect = 7e-05 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 3/91 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP---PXXXXXXXXPPPXPPRHXXPPX 867 PPPPP PP PPPPPP P PPP PP H PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPP----PVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP- 547 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P P S P P Sbjct: 548 --PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/96 (29%), Positives = 28/96 (29%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP PPPP PPP PP H PP Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP---PV 629 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P S P P P P Sbjct: 630 FSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/101 (31%), Positives = 32/101 (31%), Gaps = 4/101 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP--PPPXXXXXXXXP--PPXPPRHXXPP 864 PPPPP PP V PPPP PP P P PP H PP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHS-----PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 582 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP P P S P P P P Sbjct: 583 --PVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAX 969 PPPPP PPP PP + PP S P PP P P P P Sbjct: 510 PPPPPVYS-----PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVH 564 Query: 970 LXXP 981 P Sbjct: 565 SPPP 568 Score = 37.1 bits (82), Expect = 0.018 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 3/100 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPXPPRHXXPPX 867 PPPP P PP PPPP PP P PP P Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 588 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P S P P P P Sbjct: 589 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 35.5 bits (78), Expect = 0.055 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 10/84 (11%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP--PPPXXXXXXXXPPPX------PPRH 852 PPPPP PP PPPP PP PPP PP+ Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKM 676 Query: 853 XXPPXSXXXSXPXP--PSXLXXAP 918 PP + P P PS AP Sbjct: 677 SSPPTQTPVNSPPPRTPSQTVEAP 700 Score = 33.9 bits (74), Expect = 0.17 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 6/101 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPP---PXPPRHXX 858 PPPP P PP PPPP PP PP P PP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYS 668 Query: 859 PPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PP P +P P P P P Sbjct: 669 PPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIP 709 Score = 32.7 bits (71), Expect = 0.39 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPR-HXXPPXSX 873 PPP P PP P P P P PP H PP S Sbjct: 447 PPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSP 506 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP +P P P P P P Sbjct: 507 IHSPPPPP---VYSPPPPPPVYSPPPPPPVYSPPPPPP 541 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP P A P P PP P PPP SPP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P P PP L PPPPP PP PP PP S Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSL-------PPPPPAALFPPLPPPPSQPP---PPPLSPP 1118 Query: 877 XSXPXPP 897 S P PP Sbjct: 1119 PSPPPPP 1125 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPP PP PP PP PP P PP P P P P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PP P PP ++ P P PP PPP S P S P Sbjct: 1070 PPLPPLPPSPPPPSPPLPP--SSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Query: 965 P 967 P Sbjct: 1128 P 1128 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = +1 Query: 700 PPPPXXPLXP----PXXXXXLAXXVXXFXXXXPPPP--PPPXXXXXXXXPPPXPP 846 PPPP PL P P L + PPPP PPP PPP PP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPP-----SPPPPPPPP 1128 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 P PPP PPP PP PP S P PP P P S P P Sbjct: 1065 PQESPPPLPPLPPSPPPPSPP---LPPSSL----PPPPPAALFPPLPPPP----SQPPPP 1113 Query: 964 AXLXXPRP 987 P P Sbjct: 1114 PLSPPPSP 1121 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 P P PPP PP PP S P PPS L P Sbjct: 1056 PLPEDSPPLPQESPPPLPP---LPPSPPPPSPPLPPSSLPPPP 1095 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLP 902 PP P P PP PP P P P L PP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/89 (29%), Positives = 28/89 (31%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPP P PP A PP PPP P P PP + PP Sbjct: 118 PPPESSPPPPPPTE---APPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PP L P P P+P A Sbjct: 175 PSHSPPRHLPSPPASEIPPPPRHLPSPPA 203 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/86 (26%), Positives = 26/86 (30%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXS 882 PPP PL P PPP P PPP P PP + S Sbjct: 62 PPPETPLSSPPPEPSPPSP----SLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSS 117 Query: 883 XPXPPSXLXXAPXXXXPXXXXSXPAP 960 P S P P + P+P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSP 143 Score = 34.3 bits (75), Expect = 0.13 Identities = 29/95 (30%), Positives = 30/95 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P P P A V PPPPPP PP P PP + Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEA-----PPTTPITSPSPPTNP- 147 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P PP P P S P P L P Sbjct: 148 ---PPPPESPPSLPAPDPP----SNPLPPPKLVPP 175 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP PP T P PP P PPP SPP Sbjct: 124 PPPPPPTEAPP-----------TTPITSPSPPTNPPPPPESPP 155 Score = 34.3 bits (75), Expect = 0.13 Identities = 27/103 (26%), Positives = 28/103 (27%), Gaps = 7/103 (6%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXP-------PPXPPRHXX 858 P PP P PP L PP PP P PP P Sbjct: 141 PSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPS 200 Query: 859 PPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP S S P S P P P P + P P Sbjct: 201 PPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSP 243 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP-XXXXPXXXXSXPAPX 963 PPP P PP P PP + S P PS P P S P P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE 121 Query: 964 AXLXXPRP 987 + P P Sbjct: 122 SSPPPPPP 129 Score = 31.9 bits (69), Expect = 0.68 Identities = 22/88 (25%), Positives = 25/88 (28%), Gaps = 1/88 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP-PXXXXXXXXPPPXPPRHXXPPXSX 873 PPP P P P + P PPPP P P PP PP Sbjct: 71 PPPEPSPP--SPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPA 957 P +P P S P+ Sbjct: 129 PTEAPPTTPITSPSPPTNPPPPPESPPS 156 Score = 31.9 bits (69), Expect = 0.68 Identities = 25/97 (25%), Positives = 27/97 (27%), Gaps = 1/97 (1%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXP-PPXPPRHXXPPXSXX 876 P PP PL PP L P PP P PP R PP Sbjct: 160 PDPPSNPLPPPK----LVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSE 215 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P+P + RP Sbjct: 216 HPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRP 252 Score = 31.5 bits (68), Expect = 0.90 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXP-PSXLXXAPXXXXPXXXXSXPAP 960 P PP P PP PP PP P P PS P P S P+P Sbjct: 241 PSPPSPSDSKRPVHPSPPSPPEETLPPPK---PSPDPLPSNSSSPPTLLPPSSVVSPPSP 297 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP P PPPP PPP R P S Sbjct: 192 PPPPRHLPSPPASERP---STPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSD 248 Query: 880 S----XPXPPS 900 S P PPS Sbjct: 249 SKRPVHPSPPS 259 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPPP PP PP + PP P PP P P S P P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 964 AXLXXPRP 987 P P Sbjct: 594 HSPPPPAP 601 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/98 (30%), Positives = 33/98 (33%), Gaps = 2/98 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P+ P + PPPPPPP P PP + PP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVY---SPPPPPPPVHSPPPPVFSPPPPVYSPPP---PV 586 Query: 880 SXPXPP--SXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP S AP P S P P P P Sbjct: 587 HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/97 (30%), Positives = 31/97 (31%), Gaps = 9/97 (9%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPP---PPPP---PXXXXXXXXPP---PXPPR 849 PPPPP PP V PP PPPP P PP P PP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 850 HXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 H PP + S P P P P P P Sbjct: 594 HSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 39.9 bits (89), Expect = 0.003 Identities = 33/102 (32%), Positives = 34/102 (33%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP---PPPPXX--XXXXXXPPPXPPRHXXP 861 PPPP P PP V PPP PPPP PPP P H P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFS----PPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPP 606 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP P P S P + PRP Sbjct: 607 P--PVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYS--PPPRP 644 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/78 (25%), Positives = 22/78 (28%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP PPPP P PP PP PP Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFS 627 Query: 880 SXPXPPSXLXXAPXXXXP 933 P + +P P Sbjct: 628 PPPSQSPPVVYSPPPRPP 645 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 2/79 (2%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPP--PPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P+ P PP PPP PPP PP+ PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQ-- 653 Query: 877 XSXPXPPSXLXXAPXXXXP 933 S P P P P Sbjct: 654 -SPPPAPVEKKETPPAHAP 671 Score = 31.5 bits (68), Expect = 0.90 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = +1 Query: 784 PPP-----PPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXS 948 PPP PPPP PPP PP H PP S P PP P P S Sbjct: 518 PPPAPVNSPPPPVYSP----PPPPPPVHSPPP--PVHSPPPPPVYSPPPP----PPPVHS 567 Query: 949 XPAP 960 P P Sbjct: 568 PPPP 571 Score = 29.5 bits (63), Expect = 3.6 Identities = 25/97 (25%), Positives = 25/97 (25%), Gaps = 3/97 (3%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP PP V PPPP PPP PP P P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHS-----PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPV 636 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P PP P P A P Sbjct: 637 VYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAP 673 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXAT-RXXPXPXPPXPPXPPPXSPP 913 P PP P T R P P P P PP SPP Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPP 534 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP P R P P PP PP PP +PP Sbjct: 125 PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXPXX 973 PPPP PP R P P PP PP PP +PP P P Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPP 156 Query: 974 P 976 P Sbjct: 157 P 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PPPP PP A PP PP PPP PP + H Sbjct: 121 PPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPP-PPPPPPPTITPPVTTTTTGHHHHR 179 Query: 965 PXXPXRA 985 P P A Sbjct: 180 PPPPPPA 186 Score = 35.9 bits (79), Expect = 0.042 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP 801 PPPPP P PP + PPPPPP Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 5/73 (6%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP-----RHXXP 861 PPPPP PL + PPPPPPP PP H Sbjct: 97 PPPPPPPPLSA------ITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRS 150 Query: 862 PXSXXXSXPXPPS 900 P P PP+ Sbjct: 151 PPPPPPPPPPPPT 163 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP--XPPRHXXPPXS 870 PPPPP P PP A + PPPPP PPP PPR PP Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKP 106 Query: 871 XXXSXP 888 + P Sbjct: 107 PQKNLP 112 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXA 923 PP P P PPP PPP P P + PP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP 103 Query: 924 PXXXAXRFXXXTPXPP 971 P P PP Sbjct: 104 PKPPQKNLPRRHPPPP 119 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 F PPPPPPP PPP PP P PP Sbjct: 38 FPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXPXXP 976 P P PP PP PPP PP S P P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 11/69 (15%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXX---------FXXXXPPPPPPPXXXXXXXXPPP--XP 843 PPPPP P PP + + PPPP PP PP P Sbjct: 53 PPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLP 112 Query: 844 PRHXXPPXS 870 RH PP S Sbjct: 113 RRHPPPPRS 121 Score = 32.7 bits (71), Expect = 0.39 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP PPP PP Sbjct: 42 PPPPPPPPPPPPPPPPP 58 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 14/68 (20%) Frame = +2 Query: 752 PXXXXXSXXXXPPXPPP----PXXPPXXXXXXXXXXATRXXPXPXP----------PXPP 889 P S PP PPP P PP T P P P P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Query: 890 XPPPXSPP 913 PPP S P Sbjct: 95 QPPPRSQP 102 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 691 GXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 G PPPPP P+ PPP PP PPP P Sbjct: 73 GIPPPPP--PVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/92 (29%), Positives = 31/92 (33%), Gaps = 4/92 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP + + PPPPPPP P PP PP S Sbjct: 572 PPPPPPPP--PPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Query: 877 XS----XPXPPSXLXXAPXXXXPXXXXSXPAP 960 + PP P P + P P Sbjct: 630 STGNKRQAQPPPPPPPPPPTRIPAAKCAPPPP 661 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/96 (31%), Positives = 31/96 (32%), Gaps = 1/96 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP PPPPPP PPP PP PP S Sbjct: 618 PPPPPP----PPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP----PPTSHS 669 Query: 877 XS-XPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 S PPS P + P P A P Sbjct: 670 GSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLP 705 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/74 (31%), Positives = 25/74 (33%), Gaps = 7/74 (9%) Frame = +1 Query: 697 PPPPPXX-------PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHX 855 PPPPP P PP + + PPPPPPP P P Sbjct: 644 PPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPP 703 Query: 856 XPPXSXXXSXPXPP 897 PP S P PP Sbjct: 704 LPPSSTRLGAPPPP 717 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 6/76 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP---- 864 PPPPP P PP + PPPPPPP P PP PP Sbjct: 482 PPPPPPPP--PPLFTSTTSFSPSQ---PPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFT 536 Query: 865 --XSXXXSXPXPPSXL 906 S S P PP L Sbjct: 537 STTSFSPSQPPPPPPL 552 Score = 37.5 bits (83), Expect = 0.014 Identities = 28/106 (26%), Positives = 31/106 (29%), Gaps = 7/106 (6%) Frame = +1 Query: 664 RSLXXXSXXGXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP-------XXXXXX 822 RS+ PP PP P PP + + PPPPPPP Sbjct: 585 RSIPPPLAQPPPPRPPPPPPPPPS-----SRSIPSPSAPPPPPPPPPSFGSTGNKRQAQP 639 Query: 823 XXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPP PP P P PP P P P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 37.1 bits (82), Expect = 0.018 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 11/99 (11%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXX------PPPXPPRHXX 858 PPPPP P PP + PPPPPPP PPP PP Sbjct: 639 PPPPPPPP--PPTR-------IPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPK 689 Query: 859 PPXSXXXSXPXPP-----SXLXXAPXXXXPXXXXSXPAP 960 S P PP S AP P PAP Sbjct: 690 ANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAP 728 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 697 PPPPPXXPLX-PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPPP + P PPPPPPP PPP + PP Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPP 740 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 P PPPP PP T P P PP PPP P P Sbjct: 543 PSQPPPP--PPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPP 600 Query: 965 PXXP 976 P P Sbjct: 601 PPPP 604 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXP 967 P PPPP PP +R P P PP PP PP S P P Sbjct: 572 PPPPPPPPPPLP---------SRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Query: 968 XXP 976 P Sbjct: 623 PPP 625 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/66 (31%), Positives = 24/66 (36%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PPPP PP ++R P P P P PPP P + P Sbjct: 596 PPRPPPPPPPPP---------SSRSIPSPSAP--PPPPPPPPSFGSTGNKRQAQPPPPPP 644 Query: 965 PXXPXR 982 P P R Sbjct: 645 PPPPTR 650 Score = 32.3 bits (70), Expect = 0.51 Identities = 32/110 (29%), Positives = 33/110 (30%), Gaps = 13/110 (11%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP----------XXXXXXXXPPPXPP 846 PPPPP PL PPPPP P PPP PP Sbjct: 526 PPPPPPPPL--------FTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPP 577 Query: 847 RHXXPPXSXXXSXPXP---PSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP S P P P P P S P+P A P P Sbjct: 578 ---PPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +2 Query: 785 PPXPPPPXX-----PPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP P +TR P PP PP +PP Sbjct: 682 PPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP 729 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPP 901 P PPPP PP + R P PP PP PPP Sbjct: 658 PPPPPP--PP-----TSHSGSIRVGPPSTPPPPPPPPP 688 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 691 GXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP 837 G PPPPP PP A PPPPP PPP Sbjct: 712 GAPPPPP-----PPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 29.9 bits (64), Expect = 2.7 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 12/109 (11%) Frame = +1 Query: 697 PPPPPXXPLX------------PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPX 840 PPPPP PL PP L F PPPPPP Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP--PPPLFTSTTSF 541 Query: 841 PPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P P P P P P Sbjct: 542 SPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPP 590 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 5/71 (7%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX--PPPPPPPXXXXXXXXPPPXPPR---HXXPP 864 P PP P PP A P PPPPP PPP R PP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Query: 865 XSXXXSXPXPP 897 S PP Sbjct: 756 LGAKGSNAPPP 766 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/74 (28%), Positives = 23/74 (31%), Gaps = 11/74 (14%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXP-----------PXPPPXSPPXXXXXXX 934 P PPPP PP A + P P PP P P PP PP Sbjct: 639 PPPPPPPPPPTRIP------AAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANI 692 Query: 935 XXSXXXXHPXPXXP 976 + P P P Sbjct: 693 SNAPKPPAPPPLPP 706 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXP 895 P PPPP PP T P PP PP P Sbjct: 522 PSQPPPPPPPP-----PLFTSTTSFSPSQPPPPPPLP 553 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSP 200 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 201 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 242 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 240 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 241 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 282 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 290 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 291 PPPPYVYSSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYTSPPP 332 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP 300 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 301 PPPPYVYSSPPPPPYVYKSP-PPPPYVYTSPPPPPYVYKSPPP 342 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 71 PPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 130 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 131 PPPPYVYSSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYSPPPP 172 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 220 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 221 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 262 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/104 (28%), Positives = 33/104 (31%), Gaps = 7/104 (6%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHX 855 PPPPP P PP + PPP PPPP PPP Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSS 189 Query: 856 XPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP P PP + +P P S P P P P Sbjct: 190 PPPPPYVYKSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYSSPPP 232 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/103 (28%), Positives = 34/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 250 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P PP + +P P S P P P P Sbjct: 251 PPPPYVYKSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYSSPPP 292 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/103 (27%), Positives = 33/103 (32%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 140 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P P P P Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP 183 Score = 41.5 bits (93), Expect = 8e-04 Identities = 29/103 (28%), Positives = 31/103 (30%), Gaps = 8/103 (7%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRH 852 PPPPP P PP + PPP PPPP PPP + Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKS 319 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PP S P PP P PAP P Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 41.5 bits (93), Expect = 8e-04 Identities = 28/103 (27%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRH-XX 858 PPPP PP + + PPPPP PP PPP P + Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP 320 Query: 859 PPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + P PP + +P P P P + P P Sbjct: 321 PPPPYVYTSPPPPPYVYKSP-PPPPYVDSYSPPPAPYVYKPPP 362 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/103 (26%), Positives = 32/103 (31%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP 310 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P PP + +P P P P P Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPP 353 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/102 (28%), Positives = 33/102 (32%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRHXXP 861 P PPP PP + PPP PPPP PPP + P Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 113 PP-YVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYSSPPP 152 Score = 36.3 bits (80), Expect = 0.031 Identities = 31/106 (29%), Positives = 34/106 (32%), Gaps = 9/106 (8%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP----PPP-----PPPXXXXXXXXPPPXPPR 849 P P P PL PP V P PPP PPP PPP Sbjct: 29 PTPTPYSPL-PPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVY 87 Query: 850 HXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + PP S P PP + +P P S P P P P Sbjct: 88 NSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 132 Score = 33.9 bits (74), Expect = 0.17 Identities = 27/97 (27%), Positives = 29/97 (29%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP + PPPPP PPP P + PP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPP-PYVYKSPPPPPY---VYTSPPPPPYVYKSPPPPPY 345 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP AP P P P P P Sbjct: 346 VDSYSPP----PAPYVYKPPPYVYKPPPYVYNYSPPP 378 Score = 32.3 bits (70), Expect = 0.51 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPP 864 PPPPP PP + PPP PPP PPP P + PP Sbjct: 330 PPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYS--PPPAPYVYKPPP 387 Query: 865 XSXXXSXPXPP 897 S P P Sbjct: 388 YVYSYSPPPAP 398 Score = 29.9 bits (64), Expect = 2.7 Identities = 27/99 (27%), Positives = 31/99 (31%), Gaps = 3/99 (3%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPXPPRHXXPPXS 870 PPP PP V + PPP P P PPP P + PP Sbjct: 351 PPPAPYVYKPPPYVYKPPPYVYNY---SPPPAPYVYKPPPYVYSYSPPPAPYVYKPPP-- 405 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S PP+ P P S P+P P P Sbjct: 406 YVYSYSPPPAPYVYKP----PPYVYSSPSPPPYYSSPSP 440 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP 110 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 111 PPPPYVYSSPPPPPYVYKSP-PPPPYVYNSPPPPPYVYKSPPP 152 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP 150 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 151 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 192 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 170 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 171 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 212 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 210 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 211 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 252 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 230 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 231 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 272 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 250 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 251 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 292 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 270 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 271 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 312 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 290 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 291 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 332 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 310 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 311 PPPPYVYSSPPPPPYVYKSP-PPPPYVYNSPPPPPYVYKSPPP 352 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/102 (27%), Positives = 31/102 (30%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP 350 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PPS P S P P P P Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/103 (29%), Positives = 35/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 190 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 191 PPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 232 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/103 (28%), Positives = 34/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXP-PRHXX 858 PPPP PP + + PPPPP PP PPP P + Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSP 340 Query: 859 PPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP P PP + +P P S P P P P Sbjct: 341 PPPPYVYKSPPPPPYVYSSP-PPSPYVYKSPPPPPYVYSSPPP 382 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/102 (28%), Positives = 31/102 (30%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP-----PPPXXXXXXXXPPPXPPRHXXP 861 PP PP PP PPPP PPP PPP P Sbjct: 32 PPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPP 91 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP + +P P S P P P P Sbjct: 92 PPPYVYSSPPPPPYIYKSP-PPPPYVYSSPPPPPYVYKSPPP 132 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/103 (28%), Positives = 34/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 341 PPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 400 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P PP + +P P S P P P P Sbjct: 401 PPPPYVYKSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYSSPPP 442 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/103 (26%), Positives = 34/103 (33%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + + PPPPP PP PPP P + P Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 330 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P + P PP + +P P+P P P Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/97 (28%), Positives = 31/97 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP + PPPPP PPP PP Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP---YVYSSPPPPPYVYKSPPPPPYV 396 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP + +P P S P P P P Sbjct: 397 YSSPPPPPYVYKSP-PPPPYVYSSPPPPPYVYKSPPP 432 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 8/76 (10%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRH 852 PPPPP P PP + PPP PPPP PPP + Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 449 Query: 853 XXPPXSXXXSXPXPPS 900 PP S P PPS Sbjct: 450 PSPPPYVYKSPPPPPS 465 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 8/75 (10%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRH 852 PPPPP P PP + PPP PPPP PPP + Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKS 459 Query: 853 XXPPXSXXXSXPXPP 897 PP S S PP Sbjct: 460 PPPPPSYSYSYSSPP 474 Score = 37.5 bits (83), Expect = 0.014 Identities = 26/103 (25%), Positives = 31/103 (30%), Gaps = 6/103 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PP P PP + + PPPPP PP PPP P + P Sbjct: 361 PPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 420 Query: 862 PXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P PP + +P P P P P Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPP 463 Score = 36.3 bits (80), Expect = 0.031 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 8/96 (8%) Frame = +1 Query: 697 PPPPPXX---PLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRH 852 PPPPP P PP + PPP PPPP PPP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSS 439 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP S PP P S P P Sbjct: 440 PPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPP 475 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP 837 PPPPP PP PPPPP PPP Sbjct: 430 PPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 44.0 bits (99), Expect = 2e-04 Identities = 31/103 (30%), Positives = 34/103 (33%), Gaps = 3/103 (2%) Frame = +1 Query: 682 SXXGXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP 861 S PPPPP P PP + + PPPPP PPP P + P Sbjct: 452 SVRAYPPPPPPSPSPPP--PYVYSSPPPPYVYSSPPPPP-----YVYSSPPPPPYVYSSP 504 Query: 862 PXSXXXSXPXPP---SXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P S P PP S P P S P P P Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAP 547 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/105 (27%), Positives = 33/105 (31%), Gaps = 8/105 (7%) Frame = +1 Query: 697 PPPPPXXPLXP--------PXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRH 852 PPPPP + P P ++ V + PP P PP PPP Sbjct: 424 PPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSS 483 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP S P PP P P S P P P P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPP---PPYVYSSPPPPYVYSSPPPP 525 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/88 (27%), Positives = 27/88 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P PPP P+ P + P PPP PP P + PP Sbjct: 655 PSPPPPSPVYYPSETQSPPPPTEYYYS--PSQSPPPTKACKEGHPPQATPSYEPPPEYSY 712 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S P PPS P S P P Sbjct: 713 SSSPPPPSPTSYFPPMPSVSYDASPPPP 740 Score = 38.3 bits (85), Expect = 0.008 Identities = 28/100 (28%), Positives = 32/100 (32%), Gaps = 3/100 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP---X 867 PPPPP PP + + PPPPPP PPP P PP Sbjct: 494 PPPPPYVYSSPPPPYVYSSPP-PPYVYSSPPPPPP-------SPPPPCPESSPPPPVVYY 545 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P PPS + P P P P P Sbjct: 546 APVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP 585 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/106 (26%), Positives = 30/106 (28%), Gaps = 9/106 (8%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP----XPPRHXXPP 864 PPPP PP + PPPP PP PPP P PP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPP 554 Query: 865 XS-----XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PPS + P P P P P Sbjct: 555 PSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600 Score = 35.5 bits (78), Expect = 0.055 Identities = 26/97 (26%), Positives = 29/97 (29%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP PP ++ V + PPPP PP PP P Sbjct: 398 PPPIYVYSSPPPPPSSKMSPTVRAY--SPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRA 455 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PPS P P S P P P P Sbjct: 456 YPPPPPPS-----PSPPPPYVYSSPPPPYVYSSPPPP 487 Score = 33.9 bits (74), Expect = 0.17 Identities = 25/97 (25%), Positives = 28/97 (28%), Gaps = 1/97 (1%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX-PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP PP + PPPP P PP P PP + Sbjct: 567 PPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVT-- 624 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PPS + P P P P P Sbjct: 625 -PSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/87 (25%), Positives = 26/87 (29%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP + P L + + PPPP PP PP P Sbjct: 383 PPPPTFKMSPEVRT--LPPPIYVYSSP-PPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAY 439 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S P PP P P+P Sbjct: 440 SPPPPPYSKMSPSVRAYPPPPPPSPSP 466 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P V PPPP P PP P PP + Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSP 597 Query: 880 SXPXP 894 P P Sbjct: 598 PPPSP 602 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 3/71 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX--- 867 PPPP P P PP PPP P PP Sbjct: 672 PPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSV 731 Query: 868 SXXXSXPXPPS 900 S S P PPS Sbjct: 732 SYDASPPPPPS 742 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/80 (21%), Positives = 22/80 (27%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXA 923 PP P P P PP P P P+ PP P+ + Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQS 671 Query: 924 PXXXAXRFXXXTPXPPXXXA 983 P + + PP A Sbjct: 672 PPPPTEYYYSPSQSPPPTKA 691 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 PPPPPP PPP PP PP P PP AP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/68 (33%), Positives = 25/68 (36%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP PPP PPP PP PP PP + Sbjct: 62 PPPPPPPPCPPPPSPPPCP----------PPPSPPP-----SPPPPQLPPPPQLPPPAPP 106 Query: 877 XSXPXPPS 900 P PP+ Sbjct: 107 KPQPSPPT 114 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP P P PPP PP PP S P P P P PAP Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXP--XPPSXLXXAPXXXXPXXXXSXPA 957 P P P P PPP PP PP S P PP L P P P+ Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPS 111 Query: 958 P 960 P Sbjct: 112 P 112 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPP P P PP PP PP P PPS P P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP-PPPQLPPPA 104 Query: 964 AXLXXPRP 987 P P Sbjct: 105 PPKPQPSP 112 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPPP PP PP PP PP P P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLP 902 PP P P PPP PPP P P P P P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXP 895 PP PPP PP P P PP P P Sbjct: 82 PPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 771 PXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXAP 926 P P PPP PP P P PP P PS P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/99 (27%), Positives = 29/99 (29%), Gaps = 4/99 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP P P + PPP PPPP P P PP PP Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 S P P P P +P A P Sbjct: 150 ASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAP 188 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/97 (27%), Positives = 30/97 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P PP L V PPPPP PP PP PP S Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP-----LDSSPPPPPDLTPPPSSPP 91 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + P P + P + P P Sbjct: 92 PPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPP 128 Score = 33.1 bits (72), Expect = 0.29 Identities = 26/95 (27%), Positives = 26/95 (27%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP PPP PP P PP PP Sbjct: 68 PPPPPLDSSPPPPPDLT------------PPPSSPPPPDAPPPIPIVFPPPIDSPPPEST 115 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 S P PP P P P L P Sbjct: 116 NS-PPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPP--PPPPPXXXXXXXXPPPXPPR---HXXP 861 P PPP L PP P PP P PP PPR H P Sbjct: 138 PAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAPPRNSSHALP 197 Query: 862 PXSXXXSXP 888 P S P Sbjct: 198 PKSTAAGGP 206 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 5/73 (6%) Frame = +1 Query: 784 PPPP-----PPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXS 948 PP P PPP PP P PP S PP+ P P S Sbjct: 9 PPAPSADSAPPPDTSSDGSAAPP--PTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVS 66 Query: 949 XPAPXAXLXXPRP 987 P P P P Sbjct: 67 SPPPPPLDSSPPP 79 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/100 (28%), Positives = 29/100 (29%), Gaps = 5/100 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP-----PPPXXXXXXXXPPPXPPRHXXP 861 PPPPP PP PPPP PP PP PP P Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP 743 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P + S P PP P P P P P Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/107 (28%), Positives = 32/107 (29%), Gaps = 10/107 (9%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPP---PXPPRHXX 858 PPPPP PP PPPP PP PP P PP H Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 706 Query: 859 PP----XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP P PP P P P P A + P P Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPP 753 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/98 (29%), Positives = 30/98 (30%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPX-XXXXXXXPPPXPPRHXXPPXSX 873 PPPP P PP + PPPPP PP PP H PP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYS-------PPPPPVHSPPPPVHSPPPPPVHSPPP--- 776 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P S P P P P Sbjct: 777 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/102 (31%), Positives = 32/102 (31%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP---PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP P PP PPP PPPP P PP H PP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVH------SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP- 729 Query: 868 SXXXSXPXPP--SXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP S AP P P P P P Sbjct: 730 -PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 35.1 bits (77), Expect = 0.073 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP PPPP P PP PP H PP Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP------IYSPPPPPVHSPPP--PVH 764 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S P PP P P S P P Sbjct: 765 SPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P P PP H PP S P PP P P S P P Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHS-PPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 33.9 bits (74), Expect = 0.17 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 8/98 (8%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXX---PPPPP---PPXXXXXXXXP--PPXPPRH 852 PPPPP PP PPPPP PP P P PP H Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVH 793 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PP S P P P P P P A Sbjct: 794 SPPP--PVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPA 829 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/79 (26%), Positives = 22/79 (27%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP P PP PPPP PPP P PP Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSP 818 Query: 877 XSXPXPPSXLXXAPXXXXP 933 P P +P P Sbjct: 819 PPKPVTPLPPATSPMANAP 837 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXP--XPXPP--XPPXPPPXSPP 913 PP PPP PP + P P PP PP PP SPP Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Score = 31.5 bits (68), Expect = 0.90 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 8/76 (10%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXP----PPXPPRH 852 PPPPP PP PPPP PPP P PP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Query: 853 XXPPXSXXXSXPXPPS 900 P S + P P S Sbjct: 826 LPPATSPMANAPTPSS 841 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXP-PXPPPXSP 910 P PPP PP + P PP P PPP SP Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 2/81 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP--PPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP P PP V P PPPP P PP PP PP + Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPT 157 Query: 871 XXXSXPXPPSXLXXAPXXXXP 933 P PP P P Sbjct: 158 PTPEAPCPPPPPTPYPPPPKP 178 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/105 (29%), Positives = 35/105 (33%), Gaps = 9/105 (8%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXX---LAXXVXXFXXXXPPP---PPPPXXXXXXXXP---PPXPPRH 852 PPPP P PP + + PPP PPPP P PP PP Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + P PP+ P P P P A P P Sbjct: 128 YTPPPPTPYT-PPPPTVKPPPPPVVTP--PPPTPTPEAPCPPPPP 169 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/97 (28%), Positives = 30/97 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP P PP V PPPPP PPP P PP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPT----PYTPPPPTPYTPPPP---- 141 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP + P P P P P+P Sbjct: 142 TVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 36.7 bits (81), Expect = 0.024 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PP PP + P P P PP P P +PP Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 785 PPXPPPPXX--PPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 P PPPP PP T P P PP P PPP P Sbjct: 135 PYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP P PP PPPPP PP P P PP PP Sbjct: 121 PPPPPTPYTPPPPTPYTPPP----PTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Query: 871 XXXSXP 888 + P Sbjct: 177 KPETCP 182 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 P PPP P T P P PP PP PP P Sbjct: 64 PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPP 123 Query: 965 PXXP 976 P P Sbjct: 124 PPTP 127 Score = 28.7 bits (61), Expect = 6.3 Identities = 17/69 (24%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXS-XXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P P P PP PP P + + PP + P P P P Sbjct: 32 PKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPP 91 Query: 961 XAXLXXPRP 987 + P P Sbjct: 92 PPYVKPPPP 100 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 41.9 bits (94), Expect = 6e-04 Identities = 37/132 (28%), Positives = 39/132 (29%), Gaps = 3/132 (2%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG GV G G G GG G G G Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRK 111 Query: 811 XXXG--GGXGGGXGXGXXXXXXXG-GXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGA 641 G GG GGG G G G G GG GG GG G + G G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGG-GASGGVGGGGKGRGGKSGGG 170 Query: 640 XXXGXGXGXRSG 605 G G G +G Sbjct: 171 AGGGVGGGVGAG 182 Score = 39.9 bits (89), Expect = 0.003 Identities = 31/121 (25%), Positives = 33/121 (27%) Frame = -1 Query: 967 GXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXG 788 G G + G G G GG G G G GGG G Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKG 107 Query: 787 GGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXGXRS 608 G G GG GG G G G GA G G G G +S Sbjct: 108 RGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKS 167 Query: 607 G 605 G Sbjct: 168 G 168 Score = 39.5 bits (88), Expect = 0.003 Identities = 33/130 (25%), Positives = 33/130 (25%), Gaps = 1/130 (0%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGX-RXXXXGXXXXGXXGXXXXXXXX 815 G G G G G G GG G G G Sbjct: 407 GASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 Query: 814 XXXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXX 635 GGG GG G G GG G GG GGVG G Sbjct: 467 SGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGG 526 Query: 634 XGXGXGXRSG 605 G G G SG Sbjct: 527 AGRGSGGASG 536 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXG-GXXXXGG 725 GRG GG G G G GGG GGG G G G GG Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGG 373 Query: 724 RGGXXGGVG 698 GG GG G Sbjct: 374 GGGSVGGGG 382 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/97 (29%), Positives = 30/97 (30%), Gaps = 2/97 (2%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXG--GXXWRGGXGGGXXLXX 813 G+G R G G G G G G G GG GGG Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG 164 Query: 812 XKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGG 702 K GGG GGG A GG G GGG Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G G G GG G G G Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Query: 811 XXXGGGXGGGXGXGXXXXXXXGG-XXXXGGRGGXXGGVG 698 GGG G G G GG G GG GGVG Sbjct: 309 SVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVG 347 Score = 37.5 bits (83), Expect = 0.014 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GA G G GA R G GG G G G Sbjct: 182 GGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAG 241 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GG GGG G G GG GGVG Sbjct: 242 GSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVG 279 Score = 37.5 bits (83), Expect = 0.014 Identities = 28/99 (28%), Positives = 29/99 (29%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGR 722 GRG GG G G G GG GG G G GG GG Sbjct: 382 GRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG-GVGGGV 440 Query: 721 GGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXGXRSG 605 GG GG G G+ G G G G Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVG 479 Score = 37.5 bits (83), Expect = 0.014 Identities = 29/104 (27%), Positives = 29/104 (27%), Gaps = 3/104 (2%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GG GV G G G GG G G G Sbjct: 475 GGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGA 534 Query: 811 XXX---GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXR 689 GGG GGG G G G GG GGVG R Sbjct: 535 SGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVGNRR 578 Score = 35.9 bits (79), Expect = 0.042 Identities = 28/95 (29%), Positives = 30/95 (31%) Frame = -3 Query: 980 GXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXG 801 G GAG G G GG G GG G G G + G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGV---GGGAGGAIGGGASG 99 Query: 800 GGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 G GGGG + A GG G GG GG Sbjct: 100 GAGGGGKGRGRKGGGGA--GGGVGGGVGAGGGAGG 132 Score = 35.9 bits (79), Expect = 0.042 Identities = 31/129 (24%), Positives = 32/129 (24%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G+ G G G GRG GG G G Sbjct: 194 GIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGR 253 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 G G GG G GG G GG G VG G Sbjct: 254 GSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGG 313 Query: 631 GXGXGXRSG 605 G G G SG Sbjct: 314 GRGSGGASG 322 Score = 35.5 bits (78), Expect = 0.055 Identities = 30/98 (30%), Positives = 30/98 (30%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GA G GV GA G G GG G G Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGG----GIGSGGGGTVGAGGRGSGGASGGGGTVGAG 223 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GG GG G G GG GGRG GGVG Sbjct: 224 GRGSGGASGGVGVGGGAGGSGGGSVGGGGRGS--GGVG 259 Score = 34.7 bits (76), Expect = 0.096 Identities = 31/124 (25%), Positives = 31/124 (25%), Gaps = 1/124 (0%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GA G V G G GG G G G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Query: 811 XXXGGGXGGGXGXGXXXXXXXG-GXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXX 635 GG G G G G G G GG G G VG G GA Sbjct: 183 GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGG 242 Query: 634 XGXG 623 G G Sbjct: 243 SGGG 246 Score = 34.7 bits (76), Expect = 0.096 Identities = 26/96 (27%), Positives = 27/96 (28%) Frame = -1 Query: 985 GAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXX 806 GA G + G G G GG G G G Sbjct: 319 GASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSV 378 Query: 805 XGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG G G G GG G GG GGVG Sbjct: 379 GGGGRGSGGASGGASGGASGG-ASGGASGGASGGVG 413 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGX 780 GAG G G GG G GG G GGG G G GG Sbjct: 331 GAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVG-GAVGGGGGGSVGGGGRGSGGAS 389 Query: 779 XXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG G GG GG Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGG 417 Score = 33.9 bits (74), Expect = 0.17 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G G GG G G G Sbjct: 277 GVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGG-GRGSGGASGGASGGASGGAGGS 335 Query: 811 XXXGGGXGGGXGXGXXXXXXXG-GXXXXGGRGGXXGGVG 698 GGG GGG G G G G G GG GG G Sbjct: 336 VGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG 374 Score = 33.9 bits (74), Expect = 0.17 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 2/131 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G G GG G G G Sbjct: 427 GVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG-GRGSGGAGGGTGGSVGAGGGVG 485 Query: 811 XXXGGGXGG--GXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAX 638 GGG GG G G G GG G GGVG GA GA Sbjct: 486 VGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGA- 544 Query: 637 XXGXGXGXRSG 605 G G G G Sbjct: 545 GGGVGGGANVG 555 Score = 33.5 bits (73), Expect = 0.22 Identities = 24/98 (24%), Positives = 26/98 (26%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G + GG G + G G G G G G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG G G G GG GG G G G Sbjct: 155 GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAG 192 Score = 33.1 bits (72), Expect = 0.29 Identities = 26/99 (26%), Positives = 27/99 (27%), Gaps = 1/99 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G G G G+ G G G G G G Sbjct: 174 GVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGG 233 Query: 811 XXXGGGXGG-GXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GG G G GG GG GG G G Sbjct: 234 VGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGG 272 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/98 (28%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWR--GGXGGGXXLXX 813 G G + GAG G G GG G GG GG GGG Sbjct: 254 GSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGG 313 Query: 812 XKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 + GG GG + A GG G GGG Sbjct: 314 GRGSGGASGGASGGA--SGGAGGSVGAGGGVGGGVGGG 349 Score = 33.1 bits (72), Expect = 0.29 Identities = 31/127 (24%), Positives = 32/127 (25%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GG G + G G G GG G G G Sbjct: 403 GASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 462 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 G G GG G G GG GG GG GA GA Sbjct: 463 GGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGG 522 Query: 631 GXGXGXR 611 G G R Sbjct: 523 GVGGAGR 529 Score = 32.3 bits (70), Expect = 0.51 Identities = 33/133 (24%), Positives = 34/133 (25%), Gaps = 4/133 (3%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G + G G GG G G G Sbjct: 115 GAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGG 174 Query: 811 XXXG---GGXGGG-XGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXG 644 G GG GG G G GG GGRG GG G G Sbjct: 175 VGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGS--GGASGGGGTVGAGGRGSGGASG 232 Query: 643 AXXXGXGXGXRSG 605 G G G G Sbjct: 233 GVGVGGGAGGSGG 245 Score = 32.3 bits (70), Expect = 0.51 Identities = 28/97 (28%), Positives = 30/97 (30%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 GRG + GA GA GG G GG GG GG Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGV--GGAVGGAV--GGA 369 Query: 806 XGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GGGGGG + A G G GG G Sbjct: 370 VGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Score = 32.3 bits (70), Expect = 0.51 Identities = 30/101 (29%), Positives = 31/101 (30%), Gaps = 4/101 (3%) Frame = -3 Query: 986 GRGXXRXAXGA-GXEXXXXGXXXXGAXXRXEGGXGXEXXXEXG--GXXWRGGXGG-GXXL 819 G G GA G G G R GG G G G GG GG G Sbjct: 437 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGA 496 Query: 818 XXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG GGG + A G RG G GG Sbjct: 497 GGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 Score = 31.9 bits (69), Expect = 0.68 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG GG G GG GG G GG GA GA G Sbjct: 355 GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Query: 622 XGXRSG 605 G G Sbjct: 415 AGGAGG 420 Score = 31.5 bits (68), Expect = 0.90 Identities = 28/94 (29%), Positives = 30/94 (31%) Frame = -3 Query: 980 GXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXG 801 G R + GAG G GG G GG GG GGG G Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGV-GGGVGGG---VRGAVG 517 Query: 800 GGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 G GGG + A GG G GGG Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGG 551 Score = 31.1 bits (67), Expect = 1.2 Identities = 27/96 (28%), Positives = 27/96 (28%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 G G G G GA GG GG GG G Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGG 431 Query: 806 XGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 GGG GGG A GG G GGGG Sbjct: 432 VGGGVGGGVG---GAVGGAVGGAVGGGGGGSVGGGG 464 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG GGG G GG G A G G GG GG Sbjct: 375 GGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGG 417 Score = 28.7 bits (61), Expect = 6.3 Identities = 30/127 (23%), Positives = 30/127 (23%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G G G GG G G Sbjct: 341 GVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGS--VGGGGRGSGGASGGASGGASG 398 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 GG GG G G GG GG GG GA G Sbjct: 399 GASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 458 Query: 631 GXGXGXR 611 G G R Sbjct: 459 SVGGGGR 465 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/99 (27%), Positives = 29/99 (29%) Frame = +1 Query: 691 GXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 G PP P P+ PP V PPPP P PP PP P Sbjct: 71 GYTPPAPVPPVSPPPP----TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSV 126 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P P P P S P P P P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 165 Score = 38.3 bits (85), Expect = 0.008 Identities = 28/105 (26%), Positives = 34/105 (32%), Gaps = 8/105 (7%) Frame = +1 Query: 697 PPPP------PXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXX--PPPXPPRH 852 PPPP P P+ PP + PPP P P PPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Query: 853 XXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P + S P PP+ P P P+P + P P Sbjct: 143 SVPSPTPPVSPP-PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/96 (25%), Positives = 25/96 (26%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 P PP P PP + P PPPP P P P Sbjct: 147 PTPPVSP-PPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP P P P P P P Sbjct: 206 SVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTP 241 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PPP P T P P PP P PP +P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/76 (25%), Positives = 23/76 (30%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXA 923 PP +P P PP PPP P P P P P+P+ Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Query: 924 PXXXAXRFXXXTPXPP 971 P + TP P Sbjct: 178 PPPVSPPPPTPTPSVP 193 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PP P P P V P PP PP PP PP Sbjct: 202 PPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPP 250 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/99 (29%), Positives = 30/99 (30%), Gaps = 3/99 (3%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP--PPXXXXXXXXPPPXP-PRHXXPPXS 870 PPP P PP P PPP PP P P P P+ PP Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P PAP A P P Sbjct: 94 KPVPCPSPPKPPAPTPKPVPPHGPPPKPAP-APTPAPSP 131 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P P PP P T P P P PP P P PP Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P P PP A P P PP P P P PP Sbjct: 25 PPGPSPCPSPPPKPQPKPPP-APSPSPCPSPPPKPQPKPVPPP 66 Score = 31.5 bits (68), Expect = 0.90 Identities = 23/88 (26%), Positives = 24/88 (27%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P PPP P PP A PP P P P P PP+ P Sbjct: 62 PVPPPACPPTPPKPQPKPAP---------PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPV 112 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP P S P P Sbjct: 113 PPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXP 967 P P P P P P P PP P P PP P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 968 XXP 976 P Sbjct: 63 VPP 65 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/97 (24%), Positives = 26/97 (26%), Gaps = 1/97 (1%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP-PXSXX 876 P P P+ PP PPP P P PPP P P P Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPK-------PPPAPSPSPCPSPPPKP 58 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P A P+P Sbjct: 59 QPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 3/67 (4%) Frame = +2 Query: 785 PPXPPP---PXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXX 955 PP P P P PP P P P P PPP P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 956 HPXPXXP 976 P P P Sbjct: 63 VPPPACP 69 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPP 898 PP PP P P A P P P P PP Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP P P PP + P P PP P PP P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP--PACPPTPP 73 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/66 (30%), Positives = 23/66 (34%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P PP + + P PP PP PPP P PP Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP-PTAPPPPPLGQTR 785 Query: 880 SXPXPP 897 + PP Sbjct: 786 APSAPP 791 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/95 (28%), Positives = 30/95 (31%), Gaps = 7/95 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP---- 864 P PPP P PP V PP PP P PPP PP PP Sbjct: 687 PRPPPPPP--PPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQS 744 Query: 865 ---XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 + S P PP+ P + P P Sbjct: 745 NGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Score = 37.1 bits (82), Expect = 0.018 Identities = 24/92 (26%), Positives = 26/92 (28%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP + PPP PP PP PP Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPP-PPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPT 765 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXL 972 S PP P + P P L Sbjct: 766 HSASPPPPTAPPPPPLGQTRAPSAPPPPPPKL 797 Score = 35.5 bits (78), Expect = 0.055 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +3 Query: 768 LPXPXPPPXPPP--XFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXAPXXXAX 941 LP P PPP PPP + P P P+ PP P P P + Sbjct: 686 LPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSN 745 Query: 942 RFXXXTPXPPXXXAP 986 PP AP Sbjct: 746 GISAMKSSPPAPPAP 760 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXP------PPXSPP 913 P P PP PP P P PP PP P PP PP Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/76 (27%), Positives = 22/76 (28%), Gaps = 11/76 (14%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPX-----------PPXPPXPPPXSPPXXXXXXX 934 P PPPP PP P P PP PP PPP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNG 746 Query: 935 XXSXXXXHPXPXXPXR 982 + P P P R Sbjct: 747 ISAMKSSPPAPPAPPR 762 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/129 (26%), Positives = 34/129 (26%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G A GG A G G G G G G G Sbjct: 131 GGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYG 190 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 GGG GGG G GG GG GG GG G G G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGG-GGAYGGGGAHGGGYGSGGGEGGGYGGGAAG 249 Query: 631 GXGXGXRSG 605 G G G G Sbjct: 250 GYGGGGGGG 258 Score = 39.5 bits (88), Expect = 0.003 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 G G GA G G G G E G GG G Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGA 164 Query: 806 XGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GGGGG G A GG G GGGG Sbjct: 165 YGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 36.3 bits (80), Expect = 0.031 Identities = 33/132 (25%), Positives = 33/132 (25%), Gaps = 3/132 (2%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G G G GG G G G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAA 95 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGG---VGXXRPXXPXXEXXPGAXXGA 641 G G G G G GG GG G GG G G GA Sbjct: 96 SSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGA 155 Query: 640 XXXGXGXGXRSG 605 G G G G Sbjct: 156 GASGYGGGAYGG 167 Score = 35.9 bits (79), Expect = 0.042 Identities = 34/132 (25%), Positives = 34/132 (25%), Gaps = 3/132 (2%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G GG G GA G G G G G Sbjct: 114 GAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGG 173 Query: 811 XXXGGGXGG---GXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGA 641 GG GG G G G GG GG GG GG G GA G Sbjct: 174 GGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG-GGGGSGGGGAYGGGGAHGGG 232 Query: 640 XXXGXGXGXRSG 605 G G G G Sbjct: 233 YGSGGGEGGGYG 244 Score = 34.7 bits (76), Expect = 0.096 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G A G G GG G G Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGG---GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GG GGG G G GG G GG GG G Sbjct: 245 GGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 31.9 bits (69), Expect = 0.68 Identities = 31/129 (24%), Positives = 31/129 (24%), Gaps = 2/129 (1%) Frame = -1 Query: 985 GAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXX-GXXXXXXXXXX 809 G GG G G G G GG G G G Sbjct: 58 GGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAG 117 Query: 808 XXGGGXGGGXGXGXXXXXXXGGXXXXG-GRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 GG GGG G G GG G G G GG G G Sbjct: 118 GHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Query: 631 GXGXGXRSG 605 G G G Sbjct: 178 GSAGGAHGG 186 Score = 31.9 bits (69), Expect = 0.68 Identities = 37/137 (27%), Positives = 38/137 (27%), Gaps = 8/137 (5%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXX-----GXXGXXXX 827 G GA GG G A G G G G G G G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG 205 Query: 826 XXXXXXXXGGGXGG-GXGXGXXXXXXXGGXXXXGGRGGXXGG--VGXXRPXXPXXEXXPG 656 GGG GG G G GG GG GG GG G E G Sbjct: 206 AGGYGGGGGGGSGGGGAYGG--GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Query: 655 AXXGAXXXGXGXGXRSG 605 + G G G G G Sbjct: 264 SYGGEHGGGSGGGHGGG 280 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/62 (30%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = -3 Query: 869 EXGGXXWRGGXGGGXXL----XXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGG 702 + G GG GG + + GGG GGG GG G GGG Sbjct: 32 QASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGG 91 Query: 701 GG 696 GG Sbjct: 92 GG 93 Score = 29.1 bits (62), Expect = 4.8 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 6/80 (7%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRG---GXGGGXXLXXXKXGG-GGGGGXXXXKXXTXXA 750 G+ GG G E GG G G GG G GGGGG Sbjct: 44 GSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASG 103 Query: 749 RXXXXXGGXRGXXGG--GGG 696 GG G GG GGG Sbjct: 104 AGEGGGGGYGGAAGGHAGGG 123 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PP P PP T PP PP PPP PP Sbjct: 75 PPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXS 907 PP PPPP P T P PP PP PPP S Sbjct: 78 PPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPS 118 Score = 35.9 bits (79), Expect = 0.042 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 697 PPPPPXXPLXPP--XXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPPP P PP PPPPPPP PPP PP Sbjct: 74 PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPP--------PPPPPP 117 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPPP P PPPPPPP P PP Sbjct: 81 PPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFIPP 130 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP P P PP Sbjct: 69 PSPSPPPPPPPRPPPPP 85 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXPXXP 976 P P PP P PPP SP + P P P Sbjct: 73 PPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPP 110 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/83 (30%), Positives = 27/83 (32%), Gaps = 7/83 (8%) Frame = +1 Query: 706 PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRH-------XXPP 864 PP PL P LA P PPPPP PPP PP H P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQ 65 Query: 865 XSXXXSXPXPPSXLXXAPXXXXP 933 + + P PP P P Sbjct: 66 FNQLQAPPPPPPPSAPPPLVPDP 88 Score = 34.7 bits (76), Expect = 0.096 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXX-PPPPPPPXXXXXXXXPP--PXPPRHXXP 861 PPPPP PP F PPPPPPP PP P PPRH P Sbjct: 46 PPPPPP----PPHAYYQQGPHYPQFNQLQAPPPPPPP-----SAPPPLVPDPPRHQGP 94 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/65 (30%), Positives = 23/65 (35%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP L PP + + PPPPPPP P + PP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSY---PPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPP 78 Query: 880 SXPXP 894 S P P Sbjct: 79 SAPPP 83 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP + P P PP P P PP Sbjct: 47 PPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXP--PPXPPRHXXPPXSX 873 PPPP PP V PPP PPP P P PP PP S Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVAS----PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXP 954 S P PPS P P S P Sbjct: 615 VYS-PPPPSHSPPPPVYSPPPPTFSPP 640 Score = 35.9 bits (79), Expect = 0.042 Identities = 26/95 (27%), Positives = 29/95 (30%), Gaps = 9/95 (9%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPP-----PPP----PPXXXXXXXXPPPXPPRHX 855 PPP P+ P + PP PPP PP P P PP H Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 856 XPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP P S +P P S P P Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 34.7 bits (76), Expect = 0.096 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 3/90 (3%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP PP V PPPP PPP PP PP PP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYS-----PPPPVASPPPPSPPPPVHSPPPPP-VFSPPPP 605 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P P P S P P Sbjct: 606 VFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/98 (24%), Positives = 27/98 (27%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-PPXXXXXXXXPPPXPPRHXXPPXSX 873 PPPP P + PPPP P PPP P S Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP 582 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P P P + + P P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP---PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP P P+ P + F P P PPPP P PP PP Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPT 642 Query: 868 SXXXSXP 888 P Sbjct: 643 HNTNQPP 649 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPX--PPXPPPXSPPXXXXXXXXXSXXXXH 958 PP P PP A+ P P PP PP PP SPP S Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSP 618 Query: 959 PXP 967 P P Sbjct: 619 PPP 621 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 P P PPP PP PP H PP P P P P P P Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Query: 964 AXLXXPRP 987 + P P Sbjct: 81 PHVLPPPP 88 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPPPP PP P H PP P PPS P P P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 34.7 bits (76), Expect = 0.096 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPPP P P P PPPP PPP P H PP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP--HVLPP 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 3/81 (3%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP-PXPPRHXXP--PXS 870 PP PL P P PPPP PP P P H P P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Query: 871 XXXSXPXPPSXLXXAPXXXXP 933 P PP L P P Sbjct: 73 HPHQPPPPPHVLPPPPPTPAP 93 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/88 (27%), Positives = 26/88 (29%), Gaps = 1/88 (1%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 P PP PP V PP P PP PPP P PP + Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Query: 880 S-XPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP+ P P P P Sbjct: 121 PLSPPPPAITPPPPLATTPPALPPKPLP 148 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/67 (32%), Positives = 25/67 (37%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP P PP L+ PPPP PP PP+ PP S Sbjct: 105 PPPPAITPPPPPAITPPLS----------PPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 Query: 877 XSXPXPP 897 + P PP Sbjct: 155 QTTPPPP 161 Score = 32.7 bits (71), Expect = 0.39 Identities = 21/74 (28%), Positives = 25/74 (33%), Gaps = 7/74 (9%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPP---PXPPRHXXPPXSXXXSXPXP----PSXLXXAPXXXXPXXXX 945 P PPPP PP P PP + PP + P P P L P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQ 101 Query: 946 SXPAPXAXLXXPRP 987 + P P + P P Sbjct: 102 TTPPPPPAITPPPP 115 Score = 30.7 bits (66), Expect = 1.6 Identities = 26/97 (26%), Positives = 29/97 (29%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP + P PP PP PP PP+ PP Sbjct: 31 PPPPPCICICNPGPPPPQPDP-------QPPTPPTFQPAPPANDQPPPPPQSTSPPPVAT 83 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP L P P + P P A P P Sbjct: 84 TPPALPPKPL---PPPLSP-PQTTPPPPPAITPPPPP 116 Score = 30.3 bits (65), Expect = 2.1 Identities = 25/90 (27%), Positives = 26/90 (28%), Gaps = 4/90 (4%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP----PPPXXXXXXXXPPPXPPRHXXPPXS 870 PPP P L + PPPP PPP PP PP PP Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPP--PPAITPPPPL 135 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP L P P P P Sbjct: 136 ATTPPALPPKPL---PPPLSPPQTTPPPPP 162 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -3 Query: 845 GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG GG K GGGGG G A+ GG G GGGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 35.5 bits (78), Expect = 0.055 Identities = 29/123 (23%), Positives = 31/123 (25%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G G + G G GG Sbjct: 16 GGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKG 75 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXX 632 GGG GGG G G G GG+ G GG G G G Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Query: 631 GXG 623 G G Sbjct: 136 GGG 138 Score = 35.5 bits (78), Expect = 0.055 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG GGG GG GG G GG GGG GG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGG 117 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGG 793 GG+ GGG G GG G G A GG GGGG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G G G G G G + GG GG GGG K GGG GGG Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXR--VAXXXXXXXXXXGGXXGGGGXGG 784 G GGG G GG G G R GG GGGG GG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -2 Query: 912 GGEXGGGXGGXG-GXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG+ G G GG G G G G GG GGG GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG 45 Score = 29.1 bits (62), Expect = 4.8 Identities = 24/84 (28%), Positives = 27/84 (32%), Gaps = 5/84 (5%) Frame = -3 Query: 932 GXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGG-----GXXXXK 768 G G+ +GG G GG G GG GGGGGG G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSS 62 Query: 767 XXTXXARXXXXXGGXRGXXGGGGG 696 + GG G GGGG Sbjct: 63 YISRDNFESDPKGGSGGGGKGGGG 86 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGX-EXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G G G G GG G GG W GG GGG GGG GGG Sbjct: 111 GPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGP-GYGSGGGGIGGG 169 Query: 782 XXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 G G GGGGG Sbjct: 170 GGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G GG GG GGG + GG G G G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGG 164 Query: 716 XXGGGGG 696 GGGGG Sbjct: 165 GIGGGGG 171 Score = 32.7 bits (71), Expect = 0.39 Identities = 25/95 (26%), Positives = 27/95 (28%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGR 722 G G GG G G G G G GGG G G GG Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Query: 721 GGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXG 617 G GG+G G+ G G G G Sbjct: 166 IGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 860 GXXWRGG-XGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGGXP 690 G GG GGG G GGGGG GG G GGG P Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGP 157 Score = 28.7 bits (61), Expect = 6.3 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 1/99 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXX-GAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXX 815 G G GG G G G G GG G G G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGN---GGGGPGYGSGGG 164 Query: 814 XXXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GGG G G GG GG G G Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P P P P PP A PPPPPPP PPP PP S Sbjct: 239 PDPTPPPPPPPPIPVKQSAT---------PPPPPPPKLKNNGPSPPPPPPLKKTAALSSS 289 Query: 877 XSXPXPPS 900 S PP+ Sbjct: 290 ASKKPPPA 297 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +1 Query: 769 FXXXXPP---PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXX 939 F P PPPPP PPP PP P P PP L Sbjct: 236 FVKPDPTPPPPPPPPIPVKQSATPPPPPP----PKLKNNGPSPPPPPPLKKTAALSSSAS 291 Query: 940 XXSXPAP 960 PAP Sbjct: 292 KKPPPAP 298 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +1 Query: 697 PPPPPXX----PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPPP PL PP + PPPPPPP PPP PP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRA-------PPPPPPPLMRRRAPPPPPPPP 63 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPP---RHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 PPPPPP PPP PP R PP P PP AP P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPP------PPPPPLMRRRAPPPPPP 61 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP R P P PP PP P P S P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPP-PPPPPLPRPCSRP 71 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPPPPP PPP R PP P P S Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCS 69 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXL 906 P PPPPP PP PP PP + P PP L Sbjct: 14 PLPPPPPPLMRRRAPLPPPPP----PPLMRRRAPPPPPPPL 50 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 700 PPPPXXPLX----PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP 834 PPPP PL PP L PPPPPPP PP Sbjct: 30 PPPPPPPLMRRRAPPPPPPPL------MRRRAPPPPPPPPLPRPCSRPP 72 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 4/74 (5%) Frame = +1 Query: 697 PP--PPPXXPLXPPXXXXXLAXXVXXFXXXXP--PPPPPPXXXXXXXXPPPXPPRHXXPP 864 PP PPP L PP F P PPPP P PP PPR PP Sbjct: 52 PPRLPPPFPALFPPEPPLP-----PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Query: 865 XSXXXSXPXPPSXL 906 P P S L Sbjct: 107 PPPPEEPPPPASCL 120 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +2 Query: 785 PPXPP-----PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PP PP PP P P PP PPP PP Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 33.5 bits (73), Expect = 0.22 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXP--PRHXXPPXS 870 PP PP P PP L PP PP PPP P P PP Sbjct: 42 PPSPPPSPSSPPR----LPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPE 97 Query: 871 XXXSXPXPP 897 P PP Sbjct: 98 EPPREPPPP 106 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/70 (28%), Positives = 24/70 (34%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PP PP L PP + PPP PP PPP PP PP + Sbjct: 67 PPLPPRFELPPPLFPPPPLPRL-------PPPLLPPPEEPPREPPPPPPPPEEPPPPASC 119 Query: 877 XSXPXPPSXL 906 P + + Sbjct: 120 LRTKSPENGI 129 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPP----XPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 PPP PPP PPP PP PP PP L P P Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLP 94 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PPP PP P PP PP PP PP Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 29.5 bits (63), Expect = 3.6 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 3/90 (3%) Frame = +1 Query: 700 PPP---PXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPP P PL PP PP PPP PP PPR PP Sbjct: 29 PPPLVFPLLPLSPPPSPPP--------SPSSPPRLPPP-FPALFPPEPPLPPRFELPP-- 77 Query: 871 XXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P P P P Sbjct: 78 --PLFPPPPLPRLPPPLLPPPEEPPREPPP 105 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P P PP P A P PP PPP PP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPP 82 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +3 Query: 771 PXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXLXPPXPLPSXXRXXAPXXXAXRFX 950 P P PP PP F P P P L PP PLP P Sbjct: 47 PSPSSPPRLPPPFPAL--FPPEPPLPPRFELP--PPLFPPPPLPRLPPPLLPPPEEPPRE 102 Query: 951 XXTPXPPXXXAP 986 P PP P Sbjct: 103 PPPPPPPPEEPP 114 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXP 861 PPPPPPP PPP PP H P Sbjct: 48 PPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 34.7 bits (76), Expect = 0.096 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPPPPP PP PP PP S Sbjct: 47 PPPPPPPPLYFSYFSLPPPPPPPHLPPTS 75 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = -3 Query: 965 AXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGG 786 A G G G R GG G GG + GG GGG G GGGG Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGG---GGGGYSGGGGGGYERRSGGYGSGGGG 138 Query: 785 GXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 G R GG G GGGG Sbjct: 139 GGRGYGGG--GRREGGGYGGGDGGSYGGGG 166 Score = 35.9 bits (79), Expect = 0.042 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGG-GXXLXXX 810 G G R G G G G GG G GG GG GG G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Query: 809 KXGGGGGGG 783 + GGG GGG Sbjct: 149 REGGGYGGG 157 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 799 GGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGX 620 GG GGG G GG GG GG G G G G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYG-GG 146 Query: 619 GXRSG 605 G R G Sbjct: 147 GRREG 151 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 G G G G G + GG G GG GG GGG Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGG---DGGS 161 Query: 806 XGGGGGG 786 GGGGGG Sbjct: 162 YGGGGGG 168 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/98 (27%), Positives = 30/98 (30%), Gaps = 2/98 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPP P PP +A + PP PP PP PP P Sbjct: 73 PPPAVTPTSPPAPK--VAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPA 130 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXP--APXAXLXXPRP 987 S P P+ AP P P AP P P Sbjct: 131 SPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/87 (27%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = +1 Query: 706 PPXXPLXPPXXXXXLAXXVXXFXXXXPP--PPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PP P+ PP + P PPP P P PP PP Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPP--APT 123 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S P P+ AP P PAP Sbjct: 124 SPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 33.9 bits (74), Expect = 0.17 Identities = 28/95 (29%), Positives = 30/95 (31%), Gaps = 2/95 (2%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP--XXXXXXXXPPPXPPRHXXPPXSXX 876 PPP P A V P PP P PPP PP+ PP S Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQ--SPPASAP 109 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 P PP AP P PAP + P Sbjct: 110 TVSP-PPVSPPPAPTSPPPTPASPPPAPASPPPAP 143 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/92 (26%), Positives = 25/92 (27%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P+ PPPPPP PPP PP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMFDAEVL 85 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXL 972 P AP P P P L Sbjct: 86 CCCYPPTRVRREAPLPPPPLIFVGAPPPTCAL 117 Score = 34.7 bits (76), Expect = 0.096 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPPPP P P PP PP P PP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPP---PPPMRRRAPLPPPP 58 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/62 (30%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXL-XPPXPLPSXXRXX 920 PP LP P PPP PP P P P+ PP P P+ R Sbjct: 15 PPMRGRVPLPPPPPPPPPP--------MRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRV 66 Query: 921 AP 926 P Sbjct: 67 LP 68 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = -1 Query: 985 GAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXX 806 G GG G R G G GG G G Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSE 146 Query: 805 XGGGXGGGXGX--GXXXXXXXGGXXXXGGRGGXXGG 704 GGG GGG G G GG GGRGG GG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 37.1 bits (82), Expect = 0.018 Identities = 24/67 (35%), Positives = 25/67 (37%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G GG GG GGG + GGGG GG K G G Sbjct: 92 GGRGGFGGGRGGGRGSGGGYGGGGGGYGGR-GGGGRGGSDCYKCGEPGHMARDCSEGGGG 150 Query: 716 XXGGGGG 696 GGGGG Sbjct: 151 YGGGGGG 157 Score = 29.1 bits (62), Expect = 4.8 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXX-LXXX 810 G G G + G A EGG G GG GG GGG Sbjct: 117 GYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGG--GGYGGGGGYGGGGGGYGGG 174 Query: 809 KXGGGGGGG 783 GGGGGGG Sbjct: 175 GRGGGGGGG 183 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 37.5 bits (83), Expect = 0.014 Identities = 25/94 (26%), Positives = 25/94 (26%) Frame = +1 Query: 706 PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSX 885 P PL L V PP PPPP PPP P P Sbjct: 135 PNFLPLRYLLVAVLLLLSVIVLWSSDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPG 194 Query: 886 PXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P P L P P P P P P Sbjct: 195 PDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLP 228 Score = 34.7 bits (76), Expect = 0.096 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP PL PP P P P P PPP P P Sbjct: 166 PPPPYPSPLPPPPSPSPTPGP------DSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLP 219 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P L P P P P Sbjct: 220 SPGPDSPLPLPGPPPSSSPTPGPDSPLP 247 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/101 (23%), Positives = 24/101 (23%), Gaps = 4/101 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP----PXXXXXXXXPPPXPPRHXXPP 864 PPPP P P PPP P P P P PP Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 234 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P P P P P P Sbjct: 235 SSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLP 275 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PPPP PP + P P PP PP PP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 769 FXXXXPPPP-PPPXXXXXXXXPPPXPPRHXXPP 864 F PPPP PP PPP PP PP Sbjct: 4 FGTIPPPPPLPPRLELRRQRAPPPQPPPPPPPP 36 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 691 GXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPR 849 G PPPP PL P PPPPPPP PPP PPR Sbjct: 5 GTIPPPP--PLPPRLELRRQRAP----PPQPPPPPPPP--------PPPPPPR 43 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 37.5 bits (83), Expect = 0.014 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 4/71 (5%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGG--XGGGXXLXXXKXGGG--GGGGXXXXKXXTXXARXXXXXG 729 GG G GG GG GGG L GGG GGGG G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 104 Query: 728 GXRGXXGGGGG 696 G G GGGGG Sbjct: 105 GGGGHYGGGGG 115 Score = 33.9 bits (74), Expect = 0.17 Identities = 28/108 (25%), Positives = 29/108 (26%), Gaps = 1/108 (0%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXG-XGXXXXXXXGGXXXXGG 725 G G G G G G GG GGG G G GG GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 105 Query: 724 RGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXGXRSGXPPRPXXG 581 GG GG G G G G G P + G Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLNEPVQTKPG 153 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -3 Query: 932 GXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXX 753 G G GG GG G GGG G GGGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHY 103 Query: 752 ARXXXXXGGXRGXXGGGG 699 GG G GGGG Sbjct: 104 GGGGGHYGGGGGGHGGGG 121 Score = 29.1 bits (62), Expect = 4.8 Identities = 26/98 (26%), Positives = 28/98 (28%), Gaps = 2/98 (2%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXG--GGXXLXX 813 G G G G G +G G GG + GG G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHY 103 Query: 812 XKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 GG GGG GG G GGGG Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRG--GXXGGVG 698 GGG GG G G GG GG G G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 28.7 bits (61), Expect = 6.3 Identities = 27/99 (27%), Positives = 28/99 (28%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 G G G G + G G GG G GG G GGG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHY----GGGGGHYGGGGGHY----- 110 Query: 806 XGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGGXP 690 GGGGGG GG G G G P Sbjct: 111 --GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLNEP 147 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG GGG G G G G G GGGG G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 104 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR--HXXPPXSXXXSXPXPPS 900 PPPP PP PPP P+ PP S P PPS Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPS 428 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPPP P PP PP PP S P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR--HXXPPXSXXXSXPXPPS 900 PPPP PP PPP P+ PP S P PPS Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPS 428 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPPP P PP PP PP S P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPPPPP PPP PP PP S P PP+ Sbjct: 64 PPPPPP-----TSPPPPSPPPPSPPPPSPPPPSPPPPA 96 Score = 31.5 bits (68), Expect = 0.90 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P P PP PPP SPP Sbjct: 67 PPPTSPPPPSPPPPSPP 83 Score = 31.5 bits (68), Expect = 0.90 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P P PP PPP SPP Sbjct: 72 PPPPSPPPPSPPPPSPP 88 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 36.7 bits (81), Expect = 0.024 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P H PP Sbjct: 358 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPH 417 Query: 868 SXXXSXPXPP 897 PP Sbjct: 418 HPYLYKSPPP 427 Score = 33.5 bits (73), Expect = 0.22 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 330 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 387 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P S P P P Sbjct: 388 PVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPP 427 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 50 PPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 107 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 108 -PVYHSPPPP 116 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 78 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 135 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 136 -PVYHSPPPP 144 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 106 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 163 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 164 -PVYHSPPPP 172 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 134 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 191 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 192 -PVYHSPPPP 200 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 162 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 219 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 220 -PVYHSPPPP 228 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 190 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 247 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 248 -PVYHSPPPP 256 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 218 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 275 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 276 -PVYHSPPPP 284 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 246 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 303 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 304 -PVYHSPPPP 312 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PPP PPPP PPP P +H PP Sbjct: 274 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP-PVKHYSPP- 331 Query: 868 SXXXSXPXPP 897 P PP Sbjct: 332 -PVYHSPPPP 340 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/68 (26%), Positives = 20/68 (29%), Gaps = 3/68 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRH---XXPPXS 870 PPPP PP + PPPP PP P +H PP Sbjct: 293 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 352 Query: 871 XXXSXPXP 894 P P Sbjct: 353 VKHYSPPP 360 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 36.7 bits (81), Expect = 0.024 Identities = 25/97 (25%), Positives = 28/97 (28%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PP PP A PPP PP PPP PP+ PP S Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P + P P+ L PRP Sbjct: 108 TG--DSPVVIPFPKPQLPPPSLFPPPSLVNQLPDPRP 142 Score = 32.7 bits (71), Expect = 0.39 Identities = 26/90 (28%), Positives = 29/90 (32%), Gaps = 4/90 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXL-AXXVXXFXXXXPPPP---PPPXXXXXXXXPPPXPPRHXXPP 864 PPP P P PP + V F PPP PPP P P + P Sbjct: 92 PPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQLPDPRPND-NNILEP 150 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXP 954 + S P PPS P S P Sbjct: 151 INNPISLPSPPSTPFSPPSQENSGSQGSPP 180 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PP PP AT P P P PPP P Sbjct: 43 PPATSPPS-PPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPP 83 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPP-----XSXXXSXPXPPSXLXXA 915 PPPPPPP PPP P PP S P PP L A Sbjct: 10 PPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPA 58 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 760 VXXFXXXXPPPPPPPXXXXXXXXPPP-----XPPRHXXPPXSXXXSXPXPP 897 + F PPPPPP PPP P RH S P PP Sbjct: 4 ILSFTPPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPP 54 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXP---PRHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 PPPPPPP PPP P P H PP P PP P P Sbjct: 69 PPPPPPPQSL-----PPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXP--PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PPPP PPP PP+ P P P PP P P P P Sbjct: 61 PLPPPPQTP-----PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Query: 961 XAXLXXP 981 P Sbjct: 116 PLHFSSP 122 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 5/69 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRHXXP 861 P P PL PP P P PPPP PPP P P Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Query: 862 PXSXXXSXP 888 P S P Sbjct: 114 PPPLHFSSP 122 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 36.3 bits (80), Expect = 0.031 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 3/91 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP--PPPPXXXXXXXXPPPX-PPRHXXPPX 867 P PP PP PPP PPPP PPP PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P + P PAP Sbjct: 96 PVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PPP P T P PP PPP SPP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/91 (26%), Positives = 26/91 (28%), Gaps = 3/91 (3%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPP---PPPPXXXXXXXXPPPXPPRHXXPPXSX 873 P P P PP PPP PPP PP P PP + Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP----PPVSSPPPASPPPAT 86 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PP + P P PAP A Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P PP PP S P + AP P S P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/98 (22%), Positives = 25/98 (25%), Gaps = 3/98 (3%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPXPPRHXXPPXSX 873 PPP P P + PPPP PP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P +P P P P P P Sbjct: 125 APAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 P PPP PP P P P P SPP S P Sbjct: 102 PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPA 161 Query: 965 P 967 P Sbjct: 162 P 162 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 36.3 bits (80), Expect = 0.031 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 3/91 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP--PPPPXXXXXXXXPPPX-PPRHXXPPX 867 P PP PP PPP PPPP PPP PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P + P PAP Sbjct: 96 PVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PPP P T P PP PPP SPP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/91 (26%), Positives = 26/91 (28%), Gaps = 3/91 (3%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPP---PPPPXXXXXXXXPPPXPPRHXXPPXSX 873 P P P PP PPP PPP PP P PP + Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP----PPVSSPPPASPPPAT 86 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 PP + P P PAP A Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P PP PP S P + AP P S P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/98 (22%), Positives = 25/98 (25%), Gaps = 3/98 (3%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPXPPRHXXPPXSX 873 PPP P P + PPPP PP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P +P P P P P P Sbjct: 125 APAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 P PPP PP P P P P SPP S P Sbjct: 102 PATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPA 161 Query: 965 P 967 P Sbjct: 162 P 162 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 36.3 bits (80), Expect = 0.031 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXA-TRXXPXPXPPXPPXPPP 901 PP PPPP P + P P PP PP PPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP---RHXXPPXSXXXSXPXPP 897 PPPP PP PPP PP + PP P PP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/64 (32%), Positives = 23/64 (35%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP P PP PPPP PP P P PP PP + Sbjct: 49 PPPPPSPP--PPSCTPS------------PPPPSPPPPKKSSCPPSPLPPPPPPPPPNYV 94 Query: 877 XSXP 888 + P Sbjct: 95 FTYP 98 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPP---PXPPRHXXPPXSXXXSXPXPP 897 PPPPP P PP P PP+ P S P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 31.5 bits (68), Expect = 0.90 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 863 PXPXPPXP---PXPPPXSPPXXXXXXXXXSXXXXHPXPXXP 976 P P PP P P PPP SPP S P P P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 31.5 bits (68), Expect = 0.90 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP 834 PPPP P PP PPPPPPP PP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCP-PSPLPPPPPPPPPNYVFTYPP 99 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXP--XPXPPXPPXPPPXSPP 913 PPPP PP + P PP P PPP PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.9 bits (79), Expect = 0.042 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPPP PP PPPPPP PPP P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPA-------APPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXP-PRHXXPPXSXXXSXPXPP 897 PPPPPPP PPP P + PP S PP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 35.1 bits (77), Expect = 0.073 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPPPPPP PPP PP P P PP P P P P Sbjct: 384 PPPPPPP----SAAAPPPPPPPKKGP---AAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 Score = 32.7 bits (71), Expect = 0.39 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP PPPPP PPP PP P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAA---------PPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Query: 877 XSXPXP 894 + P Sbjct: 437 GNPKGP 442 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PP P A P P P PPP PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/73 (24%), Positives = 20/73 (27%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXS 948 F PP PP PPP P PP P P P Sbjct: 366 FTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAP---PPPPPPGKKGAGPP 422 Query: 949 XPAPXAXLXXPRP 987 P P + P+P Sbjct: 423 PPPPMSKKGPPKP 435 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 35.1 bits (77), Expect = 0.073 Identities = 20/73 (27%), Positives = 24/73 (32%), Gaps = 7/73 (9%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP-------XXXXXXXXPPPXPPRHX 855 PPPPP P+ + PPPPPPP PPP PP+ Sbjct: 572 PPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPPKKL 631 Query: 856 XPPXSXXXSXPXP 894 + P P Sbjct: 632 LATTNPPPPPPPP 644 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/67 (28%), Positives = 22/67 (32%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP L + + PPPPPP P PP PP Sbjct: 575 PPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPP--PLPPKKLL 632 Query: 877 XSXPXPP 897 + PP Sbjct: 633 ATTNPPP 639 Score = 31.9 bits (69), Expect = 0.68 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 691 GXPPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 G PPPPP PL + PPP PP PPP PP Sbjct: 600 GPPPPPPPPPLQSHRSALSSSPL--------PPPLPPKKLLATTNPPPPPPP 643 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPPPP P P + P PP Sbjct: 572 PPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPP 609 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP-PXXXXXXXXPPPXP 843 PPPPP PL + PPPP P P PP P Sbjct: 637 PPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAPAPLSRSHNGNIPPVP 686 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 797 PPPXXPPXXXXXXXXXXATRXXPXPXPP----XPPXPPPXSPP 913 PPP PP ++ P P PP PPP PP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 27.5 bits (58), Expect(2) = 0.047 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 5/68 (7%) Frame = +3 Query: 783 PPPXPPPXFXXXQXXXXXXPXXPXXXXPLXXXL-----XPPXPLPSXXRXXAPXXXAXRF 947 PPP PPP + P P PP PL S R AP Sbjct: 602 PPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLK 661 Query: 948 XXXTPXPP 971 P PP Sbjct: 662 SPPVPPPP 669 Score = 27.1 bits (57), Expect(2) = 0.047 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXPPP 803 PP L P PPP PPP Sbjct: 560 PPLKPLRILSRPPPPPPPPP 579 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 35.5 bits (78), Expect = 0.055 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPP 837 PPPPP + PP + + PP PPP PPP Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 33.9 bits (74), Expect = 0.17 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 P PP PL PP L PPPPP P PP PP PP Sbjct: 198 PLPPLPPL-PPTTGLTLPHS------PFPPPPPGPPPKEQDFVRPPLPP----PPQLPQS 246 Query: 880 SXPXPP 897 S P PP Sbjct: 247 SQPPPP 252 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 35.5 bits (78), Expect = 0.055 Identities = 27/96 (28%), Positives = 33/96 (34%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPP P PP + PPPP PPP PP PP + Sbjct: 35 PPPVTPPPSPPQSPPPVVSS--------SPPPPVVSSPPPSSSPPPSPPVITSPPPTVAS 86 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S PP + +P P + PAP + P P Sbjct: 87 S--PPPPVVIASPPPSTP--ATTPPAPPQTVSPPPP 118 Score = 35.5 bits (78), Expect = 0.055 Identities = 23/95 (24%), Positives = 24/95 (25%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PP PP PP V P P PPP P PP Sbjct: 71 PPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTT 130 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 + P PS P S P P P Sbjct: 131 TNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTP 165 Score = 34.7 bits (76), Expect = 0.096 Identities = 23/94 (24%), Positives = 24/94 (25%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP PPPP P P PP Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPS 147 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PS +P P S P P A P Sbjct: 148 PPGETPSPPKPSPSTPTPTTTTSPPPPPATSASP 181 Score = 32.3 bits (70), Expect = 0.51 Identities = 28/101 (27%), Positives = 31/101 (30%), Gaps = 5/101 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PP + V PPP PPPP PPP P PP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVIT----SPPPTVASSPPPPVVIAS---PPPSTPA-TTPP 107 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP +P P+P P P Sbjct: 108 APPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSP 148 Score = 31.9 bits (69), Expect = 0.68 Identities = 26/101 (25%), Positives = 30/101 (29%), Gaps = 5/101 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP---PXPPRHXX--P 861 PP PP PP + PPP P P PP P PP+ P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPT--TTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPR 984 + S P PP+ P P P PR Sbjct: 164 TPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPR 204 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXP--XPPXPPXPPPXSPP 913 P PPP PP + P P P P PP SPP Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 28.7 bits (61), Expect = 6.3 Identities = 26/96 (27%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = +1 Query: 706 PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSX 885 PP L PP P PPP PPP PP+ P S S Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVT------PPPSPPQSPPPVVS---SS 55 Query: 886 PXPPSXLXXAPXXXXP--XXXXSXPAPXAXLXXPRP 987 P PP P P + P P P P Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/64 (23%), Positives = 18/64 (28%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PP PP ++ P PP P +PP P Sbjct: 65 PPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPS 124 Query: 965 PXXP 976 P P Sbjct: 125 PPAP 128 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.5 bits (78), Expect = 0.055 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPP PPP PP+ PP P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 34.7 bits (76), Expect = 0.096 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPP PPP P PP P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 793 PPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPPP PPP PP PP + P P AP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 800 PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P A P P PP PP P P PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 784 PPPPPP---PXXXXXXXXPPPXPPRHXXP 861 PPPPPP P PPP PP+ P Sbjct: 278 PPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 35.5 bits (78), Expect = 0.055 Identities = 26/70 (37%), Positives = 27/70 (38%) Frame = -3 Query: 905 RXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGG 726 R G G E GG W G GGG GGGGGGG + GG Sbjct: 24 RSNGYEGEEEWGGAGGGEWGGAEGGGAW-----GGGGGGGGAWGGE-----GEGGGEWGG 73 Query: 725 XRGXXGGGGG 696 G GGGGG Sbjct: 74 --GGEGGGGG 81 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GGE GG GG G G A GG GGGG GG Sbjct: 39 GGEWGGAEGGGAWGGGGGGGGA---WGGEGEGGGEWGGGGEGG 78 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 35.5 bits (78), Expect = 0.055 Identities = 31/96 (32%), Positives = 32/96 (33%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXK 807 G G G G G G R EGG G GG RGG GG + Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG--GGYSSRGGGGGSYGGGRRE 154 Query: 806 XGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 GGG GGG GG G GGGG Sbjct: 155 GGGGYGGGEG---------------GGYGGSGGGGG 175 Score = 32.3 bits (70), Expect = 0.51 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = -3 Query: 914 AXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGG----GGGXXXXKXXTXXAR 747 A R GG G GG +R G GGG GGGG GGG +R Sbjct: 84 AQSRGSGGGGGHRGG--GGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSR 141 Query: 746 XXXXXGGXRGXXGGGGG 696 G GGGG Sbjct: 142 GGGGGSYGGGRREGGGG 158 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPG--AXXGAXXXG 629 G G GGG G GG G GG GG G R G + G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 147 Query: 628 XGXGXRSG 605 G G R G Sbjct: 148 YGGGRREG 155 Score = 29.1 bits (62), Expect = 4.8 Identities = 24/77 (31%), Positives = 28/77 (36%), Gaps = 3/77 (3%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGG-GXXLXXXKXGGG--GGGGXXXXKXXTXXAR 747 G R GG G GG + GG G G + GGG GGGG + + Sbjct: 92 GGGHRGGGGGGYR---SGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 148 Query: 746 XXXXXGGXRGXXGGGGG 696 G G GG GG Sbjct: 149 GGGRREGGGGYGGGEGG 165 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 35.1 bits (77), Expect = 0.073 Identities = 21/72 (29%), Positives = 23/72 (31%), Gaps = 5/72 (6%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPP-----PPPPPXXXXXXXXPPPXPPRHXXP 861 PPP P PP + PP PP P PPP P + P Sbjct: 100 PPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPP 159 Query: 862 PXSXXXSXPXPP 897 P S S P P Sbjct: 160 PPSHHSSSPSNP 171 Score = 33.1 bits (72), Expect = 0.29 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPP---PPPPPXXXXXXXXPPPXPPRHXXPPX 867 PP P P P + F P P PPP P P PP Sbjct: 92 PPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPP 151 Query: 868 SXXXSXPXPPSXLXXAP 918 + S P PPS +P Sbjct: 152 TPKKSPPPPPSHHSSSP 168 Score = 28.7 bits (61), Expect = 6.3 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 P P P PPP P PP P PPS P P S P P Sbjct: 77 PSTPIPSTPSTPSPPPPAP--KKSPPPPTPKKSPSPPSLTPFVP-HPTPKKSPS-PPPTP 132 Query: 967 XLXXPRP 987 L P P Sbjct: 133 SLPPPAP 139 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 5/64 (7%) Frame = +1 Query: 784 PPPP-----PPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXS 948 PPPP PPP PP P P S P PS AP Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLP 149 Query: 949 XPAP 960 P P Sbjct: 150 PPTP 153 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P PP PPP P + PP S P P +P P PAP Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPP-SLTPFVPHPTPKKSPSP---PPTPSLPPPAP 139 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 35.1 bits (77), Expect = 0.073 Identities = 23/91 (25%), Positives = 24/91 (26%), Gaps = 4/91 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPX----PPRHXXPPX 867 P PP P P PP PPP PP PP H PP Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPT 161 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P + P P P P Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 33.5 bits (73), Expect = 0.22 Identities = 24/98 (24%), Positives = 28/98 (28%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP-PXSX 873 PPP P P P + PP P PP P P PP P P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTP----PTPTPPVITPPTPTPP 213 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P P + P P P P + P Sbjct: 214 VITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P PP P T+ P P P PP PP S P Sbjct: 99 PPHPKPPTKPHPHPKPPIVKPPTK--PPPSTPKPPTKPPPSTP 139 Score = 32.7 bits (71), Expect = 0.39 Identities = 24/98 (24%), Positives = 27/98 (27%), Gaps = 1/98 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP-PXSX 873 PP P P PP PP PP P P PP P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 + P P + P P P P + P P Sbjct: 184 VITPPTPTPPVVTPPTPTPPVITPPTPTPPV-ITPPTP 220 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/69 (26%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPX---PPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXP 954 PP PPP PPP PP PP + PP P + P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Query: 955 APXAXLXXP 981 P + P Sbjct: 179 TPTPPVITP 187 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P PP P T P PP P PP +PP Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTPPVVTPP-TPTPPVVTPP 238 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 P P PP PP P H PP + P PPS P P P Sbjct: 90 PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKP-PPS--TPKPPTKPPPSTPKPPTTKP 146 Query: 967 XLXXPRP 987 P+P Sbjct: 147 PPSTPKP 153 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P PP P T P PP P PP +PP Sbjct: 187 PPTPTPPVVTPPTPTPPVITPPTPTPPVITPP-TPTPPVVTPP 228 Score = 29.1 bits (62), Expect = 4.8 Identities = 22/89 (24%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP-PXSX 873 PP P P P PPP P P P P PP P P Sbjct: 135 PPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP-TPPVVTPPTPTPPVITPPTPTPP 193 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 + P P + P P P P Sbjct: 194 VVTPPTPTPPVITPPTPTPPVITPPTPTP 222 Score = 28.7 bits (61), Expect = 6.3 Identities = 26/101 (25%), Positives = 28/101 (27%), Gaps = 5/101 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP---PXXXXXXXXPPPXP-PRHXXPPX 867 PP P P P P P PP P P P P P PP Sbjct: 62 PPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPT 121 Query: 868 SXXXSXPXPPSXLXXA-PXXXXPXXXXSXPAPXAXLXXPRP 987 S P PP+ + P S P P P P Sbjct: 122 KPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPP 901 PP P PP P T P PP P P P Sbjct: 207 PPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 35.1 bits (77), Expect = 0.073 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGG--XGGGXXLXXXKXGGG--GGGGXXXXKXXTXXARXXXXXG 729 GG G GG GG GGG L GGG GGGG G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 Query: 728 GXRGXXGGGG 699 G G GGGG Sbjct: 105 GGGGHHGGGG 114 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXG-XGXXXXXXXGGXXXXGG 725 G G G G G G GG GGG G G GG GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGG 105 Query: 724 RGGXXGGVG 698 GG GG G Sbjct: 106 GGGHHGGGG 114 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRG--GXXGGVG 698 GGG GG G G GG GG G G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXG 787 GG GGG G G G G GG GGGG G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYG-GGGGHYGGGGGHYGGGGGG 102 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 35.1 bits (77), Expect = 0.073 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 900 GGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GGG G GG G G + GG GGGG GG Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = -3 Query: 896 GGXGXEXXXEXG-GXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXR 720 GG G G G W GG GG GGGG G K G + Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGK 117 Query: 719 GXXGGGG 699 G GG G Sbjct: 118 GVDGGAG 124 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -1 Query: 799 GGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 G GGG G GG G GG GG+G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIG 87 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.7 bits (76), Expect = 0.096 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GGG G GG GG GG GG G Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GG G G G GG GG G G Sbjct: 134 GGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSG 168 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG GGG GG GG G G G GG GG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGG 165 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 34.7 bits (76), Expect = 0.096 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXP 888 PPP P PPP P +H PP S S P Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPP 87 Score = 34.7 bits (76), Expect = 0.096 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPPP PP L+ PPPP PPP P P S Sbjct: 67 PPPPPPHKHSPPPLSQSLSPP--PLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVP 124 Query: 877 XSXPXP 894 S P P Sbjct: 125 SSPPSP 130 Score = 31.5 bits (68), Expect = 0.90 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 4/92 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP----PPXXXXXXXXPPPXPPRHXXPP 864 PPP P P L PPPPP PP PP H PP Sbjct: 44 PPPSKPSPSMSPPPSPSLP-----LSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPP 98 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP L P S P+P Sbjct: 99 RFYYFESTPPPPPLSPDGKGSPPSVPSSPPSP 130 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.7 bits (76), Expect = 0.096 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 900 GGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GGG GG GG G G R GG GGGG GG Sbjct: 88 GGGGGGRGGSGGGY-RSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 799 GGXGGG-XGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GG GGG G G GG GG GG GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 34.7 bits (76), Expect = 0.096 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPXPXX 973 P P PP R P P PP PPP PP S P P Sbjct: 280 PRVPKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Query: 974 P 976 P Sbjct: 340 P 340 Score = 34.7 bits (76), Expect = 0.096 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPP 889 P PPPP PP ++ P P PP PP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXA 915 PPPPPPP PPP + PP P PP L A Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPP-----PPPPPPKSLSIA 349 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 851 TRXXPXPXPPXPPXPPPXSPP 913 T+ P P P PP PPP PP Sbjct: 21 TKDMPSPLPLPPPPPPPLKPP 41 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 796 PPPXXXXXXXXPPPXPP--RHXXPPXSXXXSXPXPP 897 PPP PPP PP + PP S + P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 697 PPPPPXXPL---XPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PPPPP PL PP A PPPPPPP Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKA-------PPPPPPPPPP 343 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 34.7 bits (76), Expect = 0.096 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPPP P ++ PPPPPP PPP PP Sbjct: 297 PPPPPLTS--PQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPPP 344 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXP----PXPPPXSP 910 PP PP P P + R P P PP P P PPP P Sbjct: 297 PPPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPPP 344 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 34.7 bits (76), Expect = 0.096 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPPP PL P + + PPP PP PPP PP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPL-------PPPLPPKKLLATTNTPPPPPP 54 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 34.7 bits (76), Expect = 0.096 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXP--PSXLXXAPXXXXPXXXXSXPA 957 PPPP P PPP P PP + P P PS P S P+ Sbjct: 58 PPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPS 117 Query: 958 P 960 P Sbjct: 118 P 118 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 34.7 bits (76), Expect = 0.096 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG G G G G G GGRGG G + P + G G G Sbjct: 103 GGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGG 162 Query: 622 XGXRSG 605 G R G Sbjct: 163 GGGRYG 168 Score = 31.5 bits (68), Expect = 0.90 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = -3 Query: 932 GXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXX 753 G G GG G GG G GGG GGGGG K Sbjct: 88 GNSGGGGSSGGRGGFGGGGGR--GGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPG 145 Query: 752 ARXXXXXGGXRGXXGGGGG 696 G G GGGGG Sbjct: 146 HMARECSQGGGGYSGGGGG 164 Score = 30.3 bits (65), Expect = 2.1 Identities = 25/87 (28%), Positives = 28/87 (32%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGX 780 GA + G G GG G GG + GG GG + GGGG Sbjct: 83 GAPVQGNSGGGGSSGGRGGFGGGGGRGGGR--GGGSYGGGYGGRGS--GGRGGGGGDNSC 138 Query: 779 XXXKXXTXXARXXXXXGGXRGXXGGGG 699 AR GG GGGG Sbjct: 139 FKCGEPGHMARECSQGGGGYSGGGGGG 165 Score = 30.3 bits (65), Expect = 2.1 Identities = 26/92 (28%), Positives = 28/92 (30%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G + GG G G+ GRG GG R G G Sbjct: 93 GGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG-RGGGGGDNSCFKCGEPGHMAREC 151 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGG 716 GGG GG G G GG GG GG Sbjct: 152 SQGGGGYSGGGGGGRYGSGGGGG----GGGGG 179 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGG 786 GG + GG GGG GGGGGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PPPPPPP PPP PP Sbjct: 11 PPPPPPPRLLVLPPLPPPPPP 31 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXP 894 PPPPPPP P P PP P P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 34.3 bits (75), Expect = 0.13 Identities = 27/102 (26%), Positives = 32/102 (31%), Gaps = 6/102 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPP---PXPPRHXXP 861 PPPP PP + + PPPP PPP PP P PP + Sbjct: 52 PPPPYEYKSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHS 108 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P P P P +P + P P Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 150 Score = 34.3 bits (75), Expect = 0.13 Identities = 27/102 (26%), Positives = 32/102 (31%), Gaps = 6/102 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPP---PXPPRHXXP 861 PPPP PP + + PPPP PPP PP P PP + Sbjct: 100 PPPPYYYHSPPPP---VKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHS 156 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P P P P +P + P P Sbjct: 157 PPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPP 198 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/74 (28%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +1 Query: 784 PPPP---PPPXXXXXXXXPP---PXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXX 945 PPPP PPP PP P PP + P S P P P P Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPY 104 Query: 946 SXPAPXAXLXXPRP 987 +P + P P Sbjct: 105 YYHSPPPPVKSPPP 118 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/67 (28%), Positives = 23/67 (34%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP + + PPP P PPP P PP Sbjct: 148 PPPPYYYHSPPPPVK--SPPPPYYYHSPPPPVKSPPPPYLYSSPPP--PVKSPPPPVYIY 203 Query: 880 SXPXPPS 900 + P PP+ Sbjct: 204 ASPPPPT 210 Score = 28.3 bits (60), Expect = 8.3 Identities = 23/96 (23%), Positives = 24/96 (25%), Gaps = 1/96 (1%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXS 882 PPP P + PP PP PPP PP S Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPV----KSPPPPYVYS 91 Query: 883 XPXPPSXLXXAP-XXXXPXXXXSXPAPXAXLXXPRP 987 P PP P P P P P P Sbjct: 92 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 127 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PPP PP + P P P PP SPP Sbjct: 62 PPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPP 101 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPP---XPPRHXXPPXSXXXSXPXPPS 900 PPPPPPP PPP PP PP + P PP+ Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPP--PPPPMANNGFRPMPPA 269 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPP 901 P PPPP PP PP PP PPP Sbjct: 365 PPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPP 402 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPP 901 PP PPPP P ++ PP PP PPP Sbjct: 365 PPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPP 403 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPPPP PPP R PP Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPP 49 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXS---XXXSXPXPPSXLXXAPXXXXPXXXXSXP 954 PPPPPPP PPP P + P P AP P P Sbjct: 651 PPPPPPPMLVASRTAPPPHLSHVRSIPFQTRLVMGTSPLPLLVREGAPPPTLPSMSGGAP 710 Query: 955 APXAXL 972 P L Sbjct: 711 PPPPPL 716 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPR 849 PPPPPP PPP PPR Sbjct: 150 PPPPPPMPRRS---PPPPPPR 167 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPP 846 P PPPP PPP PP Sbjct: 638 PSPPPPSMSGGAPPPPPPPP 657 Score = 23.0 bits (47), Expect(2) = 0.18 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 691 GXPPPPPXXPL 723 G PPPPP P+ Sbjct: 648 GAPPPPPPPPM 658 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.22 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -3 Query: 899 EGGXGXEXXXEXGGXXWRGGXG-GGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGX 723 + G G GG + GG G GG G GGG + R GG Sbjct: 7 QDGGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGG--------SYGGRGGYGGGGG 58 Query: 722 RGXXGGGGG 696 RG GGGGG Sbjct: 59 RGNRGGGGG 67 Score = 32.3 bits (70), Expect = 0.51 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG G G G G GGRGG GG G G G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG---RGSG 80 Query: 622 XGXRSG--XPPRPXXG 581 G R G P P G Sbjct: 81 GGGRDGDWRCPNPSCG 96 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -3 Query: 893 GXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGX 714 G G G RG GGG GGGGG G GG RG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG-------NRGGGGGGYQGGDRGG 76 Query: 713 XGGGGG 696 G GGG Sbjct: 77 RGSGGG 82 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.22 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -3 Query: 899 EGGXGXEXXXEXGGXXWRGGXG-GGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGX 723 + G G GG + GG G GG G GGG + R GG Sbjct: 7 QDGGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGG--------SYGGRGGYGGGGG 58 Query: 722 RGXXGGGGG 696 RG GGGGG Sbjct: 59 RGNRGGGGG 67 Score = 32.3 bits (70), Expect = 0.51 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG G G G G GGRGG GG G G G G G Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG---RGSG 80 Query: 622 XGXRSG--XPPRPXXG 581 G R G P P G Sbjct: 81 GGGRDGDWRCPNPSCG 96 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -3 Query: 893 GXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGX 714 G G G RG GGG GGGGG G GG RG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG-------NRGGGGGGYQGGDRGG 76 Query: 713 XGGGGG 696 G GGG Sbjct: 77 RGSGGG 82 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXX-SXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 P PP P P P + PP S S P PP + +P P S P P Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPY 91 Query: 967 XLXXPRP 987 P P Sbjct: 92 VYKSPPP 98 Score = 33.5 bits (73), Expect = 0.22 Identities = 24/96 (25%), Positives = 28/96 (29%), Gaps = 1/96 (1%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPP PP + PPPPP PPP P + PP Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSP--PPPPPYIYNSPPRPPYV 92 Query: 880 -SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPR 984 P PP + +P P P PR Sbjct: 93 YKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPR 128 Score = 33.1 bits (72), Expect = 0.29 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 8/82 (9%) Frame = +1 Query: 697 PPPPPXXPLXP-PXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPP-RH- 852 PPP P P P + + PPPPP PP PP PP + Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYK 94 Query: 853 XXPPXSXXXSXPXPPSXLXXAP 918 PP S P PP+ + +P Sbjct: 95 SPPPPPFVYSSPPPPTYIYNSP 116 Score = 33.1 bits (72), Expect = 0.29 Identities = 24/93 (25%), Positives = 26/93 (27%), Gaps = 5/93 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 PPPP PP + F PPPPP P PPP P + Sbjct: 177 PPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSA 236 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP P S P P Sbjct: 237 PRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPP 269 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 6/80 (7%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXP-PRHXX 858 PPP PP + F PPPPP P PPP P + Sbjct: 107 PPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSA 166 Query: 859 PPXSXXXSXPXPPSXLXXAP 918 P S P PP + +P Sbjct: 167 PRVLFIYSSPPPPPYVYNSP 186 Score = 29.5 bits (63), Expect = 3.6 Identities = 22/74 (29%), Positives = 25/74 (33%), Gaps = 6/74 (8%) Frame = +1 Query: 784 PPPP----PPPXXXXXXXXPPPXPPRHXXPPXSXXX--SXPXPPSXLXXAPXXXXPXXXX 945 PP P PP PPP P + PP S P PP + +P P Sbjct: 36 PPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSP-PRPPYVYK 94 Query: 946 SXPAPXAXLXXPRP 987 S P P P P Sbjct: 95 SPPPPPFVYSSPPP 108 Score = 28.7 bits (61), Expect = 6.3 Identities = 27/104 (25%), Positives = 30/104 (28%), Gaps = 7/104 (6%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP-----PPXXXXXXXXPPPXPPRHXXP 861 P PP PP + + PPPPP P PPP P + Sbjct: 87 PRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSA 146 Query: 862 P--XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P PP AP S P P P P Sbjct: 147 PRIPFIYSSPPPPPYVYNSAPRVL--FIYSSPPPPPYVYNSPPP 188 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP P + P P P PPP PP Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPP 74 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPX---PPXPPXPPPXSPP 913 PP PPPP P P P PP PP PPP PP Sbjct: 34 PPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPP--PP 77 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP---PPPPPPXXXXXXXXPPPXP 843 PPPPP P P + P PPPPPP PPP P Sbjct: 33 PPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPP-------LPPPPP 77 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PPPP PP + + PP PP PPP P Sbjct: 7 PPPP--PPSGFKRYKKKRSKKMDNKEVPPPPPPPPPPVLP 44 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPP PPP PP + + S P PP Sbjct: 24 PPPPPYYYLDPPPPPPPFPPHYDYNYSNYHLSPPLPP 60 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 932 GXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G G GG G GG W GG GGG GGG G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXG 707 GGG GGG G G GG GG GG G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGG 704 GGG GGG G G GG G GG GG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGG 704 GGG GGG G G GG G GG GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G W G GGG GGGGGGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGG 89 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXG 707 GGG GGG G G GG G GG G Sbjct: 84 GGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 GG G GG GG GGG GGGGGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGG-----GGGGGGGG 92 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 784 PPPP--PPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPP PPP P PP PP S P PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PPP PP + P P PP PPP P Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PPPP PP + P P PP P P PP Sbjct: 146 PPPPESPPPESLPPPSPESPSP-PSPEPPPPSSLEPPPPP 184 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGR 722 G G G G G G GGG GG G G GGR Sbjct: 348 GYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGR 407 Query: 721 GGXXGG 704 GG GG Sbjct: 408 GGYGGG 413 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/67 (31%), Positives = 23/67 (34%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G G + GG GG + GG GGGG G G Sbjct: 242 GGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPAL----GYSG 297 Query: 716 XXGGGGG 696 GGGGG Sbjct: 298 RYGGGGG 304 Score = 29.5 bits (63), Expect = 3.6 Identities = 33/131 (25%), Positives = 33/131 (25%), Gaps = 2/131 (1%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGR-GXGGXRXXXXGXXXXGXXGXXXXXXXX 815 G G G G G GR G GG G G G Sbjct: 267 GYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDM 326 Query: 814 XXXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPG-AXXGAX 638 G GGG G G GG GG GG G G GA Sbjct: 327 YGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAG 386 Query: 637 XXGXGXGXRSG 605 G G G G Sbjct: 387 GYGAGGGGNGG 397 Score = 28.3 bits (60), Expect = 8.3 Identities = 34/127 (26%), Positives = 35/127 (27%), Gaps = 5/127 (3%) Frame = -1 Query: 889 GGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXX 710 GG G G G GGG GG G GG G GG Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYG-------GYGGEFGGYGGGGYG 281 Query: 709 GGVGXXR--PXXPXXEXXPGAXXGAXXXG---XGXGXRSGXPPRPXXGXXXXXPPXRPGP 545 GGVG R P G G G G G G P G GP Sbjct: 282 GGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGP 341 Query: 544 TXVXGXG 524 + G G Sbjct: 342 SGSYGGG 348 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 33.1 bits (72), Expect = 0.29 Identities = 26/93 (27%), Positives = 28/93 (30%), Gaps = 5/93 (5%) Frame = +1 Query: 697 PPPPPXX-----PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP 861 PPPPP P PP +A PPPP P PP PP P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P + PP AP P P Sbjct: 102 PPT---PISPPPKVHHPAPQAQKAFYYRQSPPP 131 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAX 969 PPPPP PPP P PP PP P P P P Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVH 113 Query: 970 LXXPR 984 P+ Sbjct: 114 HPAPQ 118 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 6/66 (9%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPP----XPPRHXXPPXSXXXSXP--XPPSXLXXAPXXXXPXXXXS 948 PPPPP PPP PP PP P PP P P Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVH 113 Query: 949 XPAPXA 966 PAP A Sbjct: 114 HPAPQA 119 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR--HXXPPXSXXXSXPXPPSXL 906 PP PPPP PP PP+ + PP S PP L Sbjct: 98 PPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPPGEL 140 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPP----XPPPXS 907 PP PPPP PP + P P PP PP PPP S Sbjct: 93 PPSPPPPSPPPP---------SQACPPPPLPPSPPKKSYCPPPPS 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPP PPP P PP PP P PPS Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSY--CPPPPS 128 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 33.1 bits (72), Expect = 0.29 Identities = 24/85 (28%), Positives = 26/85 (30%), Gaps = 6/85 (7%) Frame = +1 Query: 697 PPPPPXXPLX-PPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXP-----PPXPPRHXX 858 P PP P PP + PPPPPP P PP Sbjct: 38 PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSA 97 Query: 859 PPXSXXXSXPXPPSXLXXAPXXXXP 933 PP S S P P S +P P Sbjct: 98 PPSSLSPSSPPPLSLSPSSPPPPPP 122 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -3 Query: 851 WRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 W GG G GGGGGGG T GG +G GGGG Sbjct: 384 WGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIG---GGGGGEQGTGVGGGG 432 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = -3 Query: 980 GXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGG---GXXLXXX 810 G R A G G G G +GG G G GG GG G + Sbjct: 292 GGGRGAEGGGRGSTGEGVTDGGGRTGNKGGNGGSIKIGVGTNGITGGTGGGEAGAGMQVM 351 Query: 809 KXGGGGGGG 783 + GGGG G Sbjct: 352 QGWGGGGSG 360 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGG 704 GGG GGG G G GG G G GG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 28.7 bits (61), Expect = 6.3 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 3/82 (3%) Frame = -3 Query: 932 GXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXX 753 G G GG G GG G GGG GGGG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQ 457 Query: 752 ARXXXXXGGXRGXXGG---GGG 696 GG RG GG GGG Sbjct: 458 GVTGSDGGGGRGRGGGKVAGGG 479 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPPPP PPP PP S P PPS Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPS 75 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 P PP PPP PP PP S P PP P P Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/56 (26%), Positives = 19/56 (33%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPA 957 PP PP PP PP+ P P P + L A P + P+ Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPSSITRPS 1188 Score = 28.7 bits (61), Expect = 6.3 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 5/72 (6%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP-----PXPPRHXXP 861 PPP P PP LA PPP P PP P P H Sbjct: 1136 PPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPSSITRPSMPSHPSL 1195 Query: 862 PXSXXXSXPXPP 897 P + P P Sbjct: 1196 PLQPGFAPPAYP 1207 >At3g13140.1 68416.m01644 hydroxyproline-rich glycoprotein family protein Length = 183 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAP 918 PPPP PP PPRH P PP AP Sbjct: 113 PPPPHVYGGNYAHPPSNPPRHSEAPRQATNPHTTPPYYSLPAP 155 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRP 686 GGG GGG G G GG G G GG G P Sbjct: 591 GGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEPP 629 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 953 GXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G + G G R EG G GG GG GG GGG GGG Sbjct: 559 GGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 32.7 bits (71), Expect = 0.39 Identities = 22/73 (30%), Positives = 24/73 (32%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXX 738 G R G G GG + GG GG GGGGG + Sbjct: 92 GGGHRGGGSYGGGGGRREGGGGYSGGGGG------YSSRGGGGGSYGGGRREGGGGYGGG 145 Query: 737 XXGGXRGXXGGGG 699 GG G GGGG Sbjct: 146 EGGGYGGSGGGGG 158 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXR 689 GG GGG G GG RGG G G R Sbjct: 98 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 135 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXG--GXXGGGGXGG 784 GG GGG G GG G G +++ G GGGG GG Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -3 Query: 899 EGGXGXEXXXEXGGXXW--RGGXGGGXXLXXXKXGGGGGGG 783 EGG G E GG +GG GGG GGGGGG Sbjct: 48 EGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 845 GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGG 702 GG GGG GGGG GG GG G GGG Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 GG G GG GG GGG G GGGG K GG R Sbjct: 34 GGSGKGQWLHGGGGEGGGGEGGG---------GEGGGGQKISK----GGGGGGSGGGQRS 80 Query: 716 XXGGGGG 696 GGGGG Sbjct: 81 SSGGGGG 87 Score = 28.3 bits (60), Expect = 8.3 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = -1 Query: 799 GGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGX 620 GG GGG G G GG GG GG G G + G + G G Sbjct: 30 GGNGGGSGKG--QWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Query: 619 G 617 G Sbjct: 88 G 88 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 27.1 bits (57), Expect(2) = 1.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 869 PXPPXPPXPPPXSP 910 P PP PP PPP P Sbjct: 280 PSPPPPPPPPPPLP 293 Score = 26.2 bits (55), Expect(2) = 1.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 848 ATRXXPXPXPPXPPXPP 898 A+ P P PP PP PP Sbjct: 275 ASEFHPSPPPPPPPPPP 291 Score = 26.2 bits (55), Expect(2) = 0.41 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPP 834 PPPPPPP PP Sbjct: 330 PPPPPPPPPVEYYKSPP 346 Score = 25.0 bits (52), Expect(2) = 0.41 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +1 Query: 709 PXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 P P + F PPPPPPP Sbjct: 258 PPSSFSSPRKSNPIPNLASEFHPSPPPPPPPP 289 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP SPP Sbjct: 330 PPPPPPPPPVEYYKSPP 346 Score = 23.0 bits (47), Expect(2) = 9.2 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 752 PXXXXXSXXXXPPXPPPPXXPP 817 P S P PPPP PP Sbjct: 270 PIPNLASEFHPSPPPPPPPPPP 291 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 875 PPXPPXPPP 901 PP PP PPP Sbjct: 329 PPPPPPPPP 337 Score = 22.6 bits (46), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 884 PPXPPPXSPP 913 PP PPP PP Sbjct: 329 PPPPPPPPPP 338 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 30.3 bits (65), Expect(2) = 0.46 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPP 864 P PP PP P P PP+H P Sbjct: 77 PEPPKPPEPEKPKPPPAPEPPKHVCKP 103 Score = 21.0 bits (42), Expect(2) = 0.46 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 697 PPPPPXXPLXPP 732 PPP P P PP Sbjct: 72 PPPKPPEPPKPP 83 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 28.3 bits (60), Expect(2) = 0.51 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP P SPP Sbjct: 371 PPPPPPPPPSPSTSSPP 387 Score = 26.2 bits (55), Expect(2) = 0.51 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPP 834 PPPPPPP PP Sbjct: 371 PPPPPPPPPSPSTSSPP 387 Score = 24.6 bits (51), Expect(2) = 0.51 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 769 FXXXXPPPPPPP 804 F PPPPPPP Sbjct: 368 FPLPPPPPPPPP 379 Score = 22.6 bits (46), Expect(2) = 0.51 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 788 PXPPPPXXPP 817 P PPPP PP Sbjct: 369 PLPPPPPPPP 378 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 32.3 bits (70), Expect = 0.51 Identities = 26/97 (26%), Positives = 29/97 (29%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P P P PP A P PP P P P P PP Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP+ P P + PAP A P+P Sbjct: 89 KPAPTPPNP-KPTPAPTPPKPKPA-PAP-APTPAPKP 122 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +1 Query: 784 PPPPPP-PXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P P PP P P P P PP P PP AP P + PAP Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKP-KPAPAPTPPKPKPA-PAP 81 Query: 961 XAXLXXPRP 987 P+P Sbjct: 82 TPPKPKPKP 90 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 1/89 (1%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPP-PXXXXXXXXPPPXPPRHXXPPXSX 873 PP P P P P P PP P P P P PP Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPK 98 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 P PP AP PAP Sbjct: 99 PTPAPTPPKP-KPAPAPAPTPAPKPKPAP 126 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/74 (24%), Positives = 19/74 (25%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 P P P P P P P P P P P PP+ P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Query: 877 XSXPXPPSXLXXAP 918 P P AP Sbjct: 117 TPAPKPKPAPKPAP 130 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 803 GGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGGXP 690 G GGGGG + GG G GGGGG P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXP 677 GGG GGG GG GG GG GG G + P Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPKMVIP 146 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 803 GGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG GGGG + GG G GGGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP P P PP T P P P PPP +P S P Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPSSVVTSPA 169 Query: 965 P 967 P Sbjct: 170 P 170 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPP 834 P PPP PP A PPPPP P PP Sbjct: 116 PNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXP--PXSX 873 PPPP P PP PPPP PPP P P P S Sbjct: 110 PPPPSTPNPPPEFSPPPP------DLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPSS 163 Query: 874 XXSXPXP 894 + P P Sbjct: 164 VVTSPAP 170 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PPP PP + P PP P PP PP P Sbjct: 468 PPIKPPPVKPPTPTYSPP----VQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPP 523 Query: 965 PXXP 976 P P Sbjct: 524 PVKP 527 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP PP + P PP P PP PP Sbjct: 518 PPIKPPPVKPPTPTYSPPI----KPPPVHKPPTPTYSPPIKPP 556 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP PP + P PP P PP PP Sbjct: 334 PPIKPPPVKPPTPIYSPP----VKPPPVHKPPTPIYSPPVKPP 372 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXXHPX 964 PP PPP P + P PP P PP PP P Sbjct: 283 PPVKPPPVHKPPTPTYSPP---VKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 339 Query: 965 PXXP 976 P P Sbjct: 340 PVKP 343 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/67 (26%), Positives = 19/67 (28%), Gaps = 3/67 (4%) Frame = +2 Query: 785 PPXP---PPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPPXXXXXXXXXSXXXX 955 PP P PP PP + P PP P PP PP Sbjct: 411 PPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPI 470 Query: 956 HPXPXXP 976 P P P Sbjct: 471 KPPPVKP 477 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP PP PP + P P PP P PP PP Sbjct: 75 PPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP P + P PP P PP PP Sbjct: 653 PPIKPPPVQKPPTPTYSPP---VKPPPVQLPPTPTYSPPVKPP 692 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/82 (23%), Positives = 22/82 (26%), Gaps = 3/82 (3%) Frame = +1 Query: 697 PPP---PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PP + + PPP P PP H P Sbjct: 505 PPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Query: 868 SXXXSXPXPPSXLXXAPXXXXP 933 + PP P P Sbjct: 565 TYSPPIKPPPVHKPPTPTYSPP 586 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP P PP PP + P P PP P PP PP Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP P PP PP + P P PP P PP PP Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 624 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP P PP PP + P P PP P PP PP Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP P PP PP + P P PP P PP PP Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 658 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP P + P PP P PP PP Sbjct: 636 PPIKPPPVHKPPTPTYSPPI---KPPPVQKPPTPTYSPPVKPP 675 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPX--PPXPPXPPPXSPP 913 PP P PP PP + P P PP P PP PP Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP P + P PP P PP PP Sbjct: 687 PPVKPPPVQVPPTPTYSPP---VKPPPVQVPPTPTYSPPIKPP 726 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/98 (22%), Positives = 24/98 (24%), Gaps = 3/98 (3%) Frame = +1 Query: 697 PPP---PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PP + PPP PP PP PP Sbjct: 118 PPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPT 177 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PP P P P + P Sbjct: 178 PTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSP 215 Score = 28.3 bits (60), Expect = 8.3 Identities = 21/98 (21%), Positives = 24/98 (24%), Gaps = 3/98 (3%) Frame = +1 Query: 697 PPP---PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PP + PPP P PP H P Sbjct: 169 PPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 + PP P P P + P Sbjct: 229 TYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSP 266 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPP P + P PP P PP PP Sbjct: 249 PPIKPPPVHKPPTPIYSPP---VKPPPVQTPPTPIYSPPVKPP 288 Score = 28.3 bits (60), Expect = 8.3 Identities = 21/98 (21%), Positives = 23/98 (23%), Gaps = 3/98 (3%) Frame = +1 Query: 697 PPP---PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PP + + PPP P PP H P Sbjct: 321 PPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PP P P P P Sbjct: 381 IYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSP 418 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/77 (25%), Positives = 23/77 (29%), Gaps = 3/77 (3%) Frame = +1 Query: 697 PPP---PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP PP PP + PP PPP PP P P Sbjct: 488 PPPVQKPPTPTYSPPVKPPPIQKPPTP--TYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP 545 Query: 868 SXXXSXPXPPSXLXXAP 918 + S P P + P Sbjct: 546 TPTYSPPIKPPPIHKPP 562 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 32.3 bits (70), Expect = 0.51 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXX- 810 GRG R G G G G R + G + GG + G GG Sbjct: 209 GRGGARGGRGGGARGGRGGSRDFGGGGR-DFGSSSDRGGRSGGRDFGGRRGGASTSSRGG 267 Query: 809 KXGGGGGGG 783 K GGG GGG Sbjct: 268 KRGGGRGGG 276 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 909 GEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 G G G G G G G + GG GGGG GG Sbjct: 161 GSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGG 202 Score = 31.9 bits (69), Expect = 0.68 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 G GG GGG G G G G GG G GGGGG Sbjct: 148 GSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGG 203 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG GGG G G G G G G G R E A G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGR-VSSSGEYSASAGGGGSGEGSG 154 Query: 622 XG 617 G Sbjct: 155 GG 156 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGV 701 GGG GGG G G G G GG G V Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSGNV 225 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG GG GG G G G G + + GG G GGGG Sbjct: 102 GGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGG 157 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 845 GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 GG G G G G G G GG G GGGGG Sbjct: 156 GGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGG 205 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -3 Query: 869 EXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGGG 696 E GG +RGG G G GGGGGGG G RG G G Sbjct: 2 ERGG--YRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRGQG 57 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 32.3 bits (70), Expect = 0.51 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXG 787 GG+ GGG GG GG G GG GGG G Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 802 GGGX--GGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GGG G G GG GG G GGVG Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPP PPP PPP P PP P PP Sbjct: 60 PPPSPPPPSPPPPACPPP-PALPPPPPKKVSSYCPPPP 96 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP P PPP PP Sbjct: 60 PPPSPPPPSPPPPACPP 76 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 32.3 bits (70), Expect = 0.51 Identities = 26/87 (29%), Positives = 29/87 (33%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGX 780 G G + G G EGG G + GG GG G G L GGGG G Sbjct: 32 GEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGG-GHGDGLGCS--GGGGDGTK 88 Query: 779 XXXKXXTXXARXXXXXGGXRGXXGGGG 699 + R GG G G G Sbjct: 89 GGGRRGDGLGRGLGRGGGRGGWNGRKG 115 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -3 Query: 899 EGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXR 720 EGG G E GG G GGG + G G G R G Sbjct: 42 EGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGL 101 Query: 719 GXXGGGGG 696 G GG GG Sbjct: 102 GRGGGRGG 109 Score = 28.3 bits (60), Expect = 8.3 Identities = 27/98 (27%), Positives = 28/98 (28%) Frame = -1 Query: 991 GXGAXXXGGXGVXXXXRXAXXXGAXXRXXXGRGXGGXRXXXXGXXXXGXXGXXXXXXXXX 812 G G GG G + G G G GG G G G Sbjct: 22 GGGNTITGGGG-EGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGD-GISGGGHGDGLGC 79 Query: 811 XXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG G G G G GGRGG G G Sbjct: 80 S--GGGGDGTKGGGRRGDGLGRGLGRGGGRGGWNGRKG 115 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = -1 Query: 895 GXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGRGG 716 G GG G G G GG GG G GG GG GG Sbjct: 115 GVGGLGGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGG 174 Query: 715 XXGGVG 698 GG+G Sbjct: 175 AGGGLG 180 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.68 Identities = 21/81 (25%), Positives = 22/81 (27%), Gaps = 2/81 (2%) Frame = +1 Query: 697 PP--PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PP PPP L + F PPP P PPR PP Sbjct: 318 PPVQPPPLRGLESDEQELPYSQNKPKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQ 377 Query: 871 XXXSXPXPPSXLXXAPXXXXP 933 P PP P P Sbjct: 378 TPPPPPPPPPLAPPPPPQKRP 398 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGV 701 GGG GGG G G G G GG GGV Sbjct: 79 GGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGGV 112 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.9 bits (69), Expect = 0.68 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 6/91 (6%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PP + PPP PPPP PPP PP Sbjct: 167 PPPPFGGQGPP-----MGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPP 221 Query: 865 XSXXXSXPXPP-SXLXXAPXXXXPXXXXSXP 954 P PP + AP P P Sbjct: 222 PPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.9 bits (69), Expect = 0.68 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 6/91 (6%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP-----PPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PP + PPP PPPP PPP PP Sbjct: 167 PPPPFGGQGPP-----MGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPP 221 Query: 865 XSXXXSXPXPP-SXLXXAPXXXXPXXXXSXP 954 P PP + AP P P Sbjct: 222 PPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 31.9 bits (69), Expect = 0.68 Identities = 26/95 (27%), Positives = 28/95 (29%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P P + PPPPP PP P + PP Sbjct: 237 PPPP--PYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYY 294 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPR 984 S P P P P S P P PR Sbjct: 295 S-PSPKIDYKSPP---PPYVYSSPPPPTYYSPSPR 325 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/75 (29%), Positives = 24/75 (32%), Gaps = 9/75 (12%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPP-----PPPP----PXXXXXXXXPPPXPPRH 852 PPPP PP + PP PPPP P PPP + Sbjct: 279 PPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYN 338 Query: 853 XXPPXSXXXSXPXPP 897 PP S P PP Sbjct: 339 SLPPPYVYNSPPPPP 353 Score = 29.1 bits (62), Expect = 4.8 Identities = 21/75 (28%), Positives = 23/75 (30%), Gaps = 9/75 (12%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP--PPXXXXXXXXPP-------PXPPRH 852 PPPP P P + PPPPP P PP P PP + Sbjct: 349 PPPP--PYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPY 406 Query: 853 XXPPXSXXXSXPXPP 897 P P PP Sbjct: 407 YSPSPKITYKSPPPP 421 Score = 28.7 bits (61), Expect = 6.3 Identities = 27/97 (27%), Positives = 30/97 (30%), Gaps = 2/97 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP--PPXXXXXXXXPPPXPPRHXXPPXSX 873 PPPP P P + PPPPP P PPP P + PP Sbjct: 159 PPPP--PYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP-PYVYSFPPPPP 215 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPR 984 S P P P P S P P P+ Sbjct: 216 YYS-PSPKVGYKSPP---APYVYSSPPPPPYYSPSPK 248 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 G E GGG G G G G R G GGG GG Sbjct: 195 GSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGG 237 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 31.9 bits (69), Expect = 0.68 Identities = 19/68 (27%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXP-XXXXSXPAPX 963 P P PP P P PP + S P PS +P P P+P Sbjct: 11 PSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Query: 964 AXLXXPRP 987 L P P Sbjct: 71 GSLTPPLP 78 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXX---FXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPP P PP + PPP PP P P P PP Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP 93 Query: 871 XXXSXP-XPPS 900 S P PPS Sbjct: 94 TTPSNPRSPPS 104 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +1 Query: 697 PPPPPXXP-LXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSX 873 PP P P L PP L + P P PP P P PP + Sbjct: 55 PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQG-PPNTP 113 Query: 874 XXSXPXPPSXLXXAP 918 S P PS +P Sbjct: 114 SGSTPRTPSNTKPSP 128 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP PP PP Sbjct: 217 PPPKPPSPPRKPPPPPP 233 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 31.9 bits (69), Expect = 0.68 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -3 Query: 845 GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGG-GGXP 690 GG G G L GG G GG A GG G GGG GG P Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGGLP 93 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPP P PPP PP PP P PPS Sbjct: 158 PPPSPDFPPFSPSIPPPSPP--YFPPEPPSIPPPPPPS 193 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP P PP + P P PP P PPP SPP Sbjct: 159 PPSPDFPPFSPSIPPP--SPPYFP-PEPPSIPPPPPPSPP 195 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 31.5 bits (68), Expect = 0.90 Identities = 21/95 (22%), Positives = 27/95 (28%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PP P P+ PP + PP PP PP PP + P + Sbjct: 61 PPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPP-----IKLPPVQPPTYKPPTPTVK 115 Query: 877 XSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXP 981 PP+ P P P + P Sbjct: 116 PPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 >At5g10060.1 68418.m01165 expressed protein Length = 469 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXX-VXXFXXXXPPPPPPP 804 P PPP L PP A + PPPPPPP Sbjct: 394 PNPPPPQFLKPPVMNNPYAFGNIPLMPPGLPPPPPPP 430 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPP 897 PPPPPP P P PP PP S PP Sbjct: 238 PPPPPPSIAVKQSAPTPSPP----PPIKKGSSPSPPP 270 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXP 894 P PPPP PPP PP S S P P Sbjct: 254 PSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPP 289 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGG 716 GGG GGG G G GG GG GG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGG 704 GGG GGG G G GG GG GG GG Sbjct: 63 GGGDGGGDGGG-------GGCGGGGGCGGGGGG 88 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 887 GXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G + + GG GG GGG GGGGGGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGC-----GGGGGGG 89 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.5 bits (68), Expect = 0.90 Identities = 33/123 (26%), Positives = 34/123 (27%), Gaps = 13/123 (10%) Frame = +1 Query: 637 SPXXXXXXXRSLXXXSXXGXPPP----PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 SP S S PPP PP + PP P PPPP Sbjct: 38 SPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPP 97 Query: 805 XXXXXXXXP-----PPXPPRHXX---PPXSXXXSXPXPPSXLXXA-PXXXXPXXXXSXPA 957 P PP PP PP S P P S P S PA Sbjct: 98 TSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPA 157 Query: 958 PXA 966 P A Sbjct: 158 PPA 160 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PP PPPP PPP PP Sbjct: 52 PPSPPPPSTPTTACPPPPSPP 72 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PP PPPP PPP PP Sbjct: 99 PPQPPPPPQPLNLFSPPPPPP 119 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 P PPPPP PPP PP Sbjct: 100 PQPPPPPQPLNLFSPPPPPPP 120 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXL 906 PPPPP P PPP P S P P L Sbjct: 102 PPPPPQPLNLFSPPPPPPPPDPFSWTNPSLNFLLPNQPLGL 142 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXP 861 PPP PPP PP PP P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGG 702 G RG GGG GGGGGGG + GG G GGG Sbjct: 112 GSGRGRGSGGGGGH-----GGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXG-GXXXXGGRGGXXGG 704 GGG GGG G G G G GG GG GG Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXG-GRGGXXGG 704 GGG GGG G G G G G GG GG Sbjct: 122 GGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 905 RXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 R GG G GG RGG GG GGG GGG Sbjct: 117 RGSGGGGGHGGGGGGGGG-RGGGGGSGNGEGYGEGGGYGGG 156 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGG 796 GG GGG GG GG G G GG GGG Sbjct: 123 GGHGGGG-GGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXX 876 PPPP P PP L+ PP P PPP PPR S Sbjct: 36 PPPPQLPPPLPP-SSYGLSPTEPRVFTFFNIPPHPMMFSPPPPQPPPPPPRPCFNGVSAA 94 Query: 877 XSXPXP 894 P P Sbjct: 95 QRLPLP 100 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = -3 Query: 959 GAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G G G G +GG G + GG ++GG GG + GGGG GG Sbjct: 59 GGGGNYQGGGGNYQGGGGNYQGGGGR---YQGGGGRYQGG-GGRYQGGGGRQGGGGSGG 113 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXX 738 G GG G G + G GGG GG GG + A Sbjct: 133 GGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNA--VG 190 Query: 737 XXGGXRGXXGGGGG 696 GG GGGGG Sbjct: 191 GGGGYGSNFGGGGG 204 Score = 29.1 bits (62), Expect = 4.8 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 3/68 (4%) Frame = -1 Query: 799 GGXGGGXGXGXXXXXXXGGXXXXGGR---GGXXGGVGXXRPXXPXXEXXPGAXXGAXXXG 629 GG GG G GG GG GG GG G P G G Sbjct: 143 GGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGG 202 Query: 628 XGXGXRSG 605 G G G Sbjct: 203 GGYGVAGG 210 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 803 GGGGGGGXXXXKXXTXXARXXXXXGG-XRGXXGGGG 699 GGGGGGG + R GG RG GGGG Sbjct: 115 GGGGGGGGFARRGGYGGGRGGYARGGFGRGGFGGGG 150 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXG-GRGGXXGG 704 GGG GGG GG G GRGG GG Sbjct: 116 GGGGGGGFARRGGYGGGRGGYARGGFGRGGFGGG 149 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPPP P + P P P PPP PP PP S Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPPLVWSPPSS 306 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPPPXPP 846 F PPPPPPP PPP PP Sbjct: 422 FSMLMPPPPPPP-------PPPPPPP 440 Score = 25.0 bits (52), Expect(2) = 1.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR 849 PPPPPPP P P R Sbjct: 434 PPPPPPPLDEKVTVMPIISPER 455 Score = 24.2 bits (50), Expect(2) = 1.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 697 PPPPPXXPLXPP 732 PPPPP P PP Sbjct: 427 PPPPPPPPPPPP 438 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 860 GXXWRGGXG-GGXXLXXXKXGGGGGGG 783 G WRGG G GG + GGG GGG Sbjct: 182 GAPWRGGQGRGGQQRGGGRGGGGRGGG 208 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 860 GXXWRGGXG-GGXXLXXXKXGGGGGGG 783 G WRGG G GG + GGG GGG Sbjct: 118 GAPWRGGQGRGGQQRGGGRGGGGRGGG 144 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 860 GXXWRGGXG-GGXXLXXXKXGGGGGGG 783 G WRGG G GG + GGG GGG Sbjct: 184 GAPWRGGQGRGGQQRGGGRGGGGRGGG 210 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/62 (29%), Positives = 20/62 (32%), Gaps = 6/62 (9%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXX------LAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXX 858 PPPPP PL + PPPPPPP PP + Sbjct: 388 PPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYTQFDPQTPPRRVKSGR 447 Query: 859 PP 864 PP Sbjct: 448 PP 449 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSP 910 P P PP PP PPP P Sbjct: 296 PPPSPPPPPPPPPPQP 311 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP PPP PP Sbjct: 381 PPPSPPPPPPPPP--PP 395 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 30.7 bits (66), Expect = 1.6 Identities = 26/101 (25%), Positives = 29/101 (28%), Gaps = 13/101 (12%) Frame = +1 Query: 697 PPPP-----PXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPP-----P 837 PPPP P P P + PPPP P P PP P Sbjct: 453 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP 512 Query: 838 XPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP H P S P P P P + +P Sbjct: 513 PPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSP 553 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPP 864 P PPPP PPP PP PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR 849 PPPPPPP PPP PPR Sbjct: 32 PPPPPPP--------PPPPPPR 45 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P PP PP PPP PP Sbjct: 28 PQYYPPPPPPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PPP PP PP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPP 44 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 30.7 bits (66), Expect = 1.6 Identities = 27/110 (24%), Positives = 31/110 (28%), Gaps = 13/110 (11%) Frame = +1 Query: 697 PPPP-----PXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPP-----P 837 PPPP P P P + PPPP P P PP P Sbjct: 513 PPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP 572 Query: 838 XPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + P S P P P P +P + P P Sbjct: 573 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSP 622 Score = 30.7 bits (66), Expect = 1.6 Identities = 27/110 (24%), Positives = 30/110 (27%), Gaps = 13/110 (11%) Frame = +1 Query: 697 PPPP-----PXXPLXPPXXXXXLAXXVXXFXXXXPPPP---PPPXXXXXXXXPP-----P 837 PPPP P P P + PPPP P P PP P Sbjct: 880 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP 939 Query: 838 XPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP + P S P P P P +P P P Sbjct: 940 PPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSP 989 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWR-GGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXX 741 G R GG G GG + GG G G GG G GG + R Sbjct: 11 GRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGP-RGPGFGPRGP 69 Query: 740 XXXGGXRGXXGGGGGXP 690 G RG GGGG P Sbjct: 70 GPWSGPRGPRPGGGGGP 86 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX----PPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP PP V + PPPP PP P +H PP Sbjct: 102 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Query: 868 S 870 S Sbjct: 162 S 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPP PP P +H PP S P P P P +P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPP-PVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Query: 964 AXLXXPRP 987 P P Sbjct: 89 PVYKSPPP 96 Score = 29.5 bits (63), Expect = 3.6 Identities = 24/100 (24%), Positives = 26/100 (26%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX---PPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP PP V + PPPP P PP + PP Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Query: 871 XXXSXPXPPSXLXXAP-XXXXPXXXXSXPAPXAXLXXPRP 987 P P P P P P P P Sbjct: 106 VKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 6.3 Identities = 26/100 (26%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP PP V + PPP PPPP P PP P Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKYYS---PPPVYKSPPPPVYKS------PPPPVKHYSPP 112 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P P +P P P Sbjct: 113 PVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 152 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX----PPPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP PP V + PPPP PP P +H PP Sbjct: 102 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Query: 868 S 870 S Sbjct: 162 S 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPP PP P +H PP S P P P P +P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPP-PVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Query: 964 AXLXXPRP 987 P P Sbjct: 89 PVYKSPPP 96 Score = 29.5 bits (63), Expect = 3.6 Identities = 24/100 (24%), Positives = 26/100 (26%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXX---PPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPP PP V + PPPP P PP + PP Sbjct: 46 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Query: 871 XXXSXPXPPSXLXXAP-XXXXPXXXXSXPAPXAXLXXPRP 987 P P P P P P P P Sbjct: 106 VKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 6.3 Identities = 26/100 (26%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPP----PPPPXXXXXXXXPPPXPPRHXXPPX 867 PPPP PP V + PPP PPPP P PP P Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKYYS---PPPVYKSPPPPVYKS------PPPPVKHYSPP 112 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P P +P P P Sbjct: 113 PVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 152 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 30.7 bits (66), Expect = 1.6 Identities = 29/101 (28%), Positives = 31/101 (30%), Gaps = 4/101 (3%) Frame = -3 Query: 986 GRGXXRXAXGAGXEXXXXGXXXXGAXXRXEGGXGXEXXXEXGGXXWRGGXGG-GXXLXXX 810 GRG R G G G R GG G G RGG G G Sbjct: 9 GRGDGRGRGGGGDRGRGYSGRGDG---RGRGGDGDRGYSGRGDGHGRGGGGDRGRGYSGR 65 Query: 809 KXGGGGGGGXXXXKXXTXXARXXXXXGG---XRGXXGGGGG 696 G G GGG + + GG RG G G G Sbjct: 66 GDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRGRG 106 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PP PP PPPPPPP Sbjct: 74 PPQTNHPKPPNSRLVKVRPAPLTQLNHPPPPPPP 107 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PPPPPPP P P Sbjct: 103 PPPPPPPPVQSVPIASEPVQP 123 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PP PP PPPPPPP Sbjct: 74 PPQTNHPKPPNSRLVKVRPAPLTQLNHPPPPPPP 107 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PPPPPPP P P Sbjct: 103 PPPPPPPPVQSVPIASEPVQP 123 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P P PP PPP +PP Sbjct: 267 PPPSSPPPPPPPPPTPP 283 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Frame = +1 Query: 697 PP--PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PP PPP P P L + PP P PP PP P Sbjct: 326 PPYQPPPQQPQYPQQPPPQLQHP-SGYNPEEPPYPQQSYPPNPPRQPPSHPPPGSAPSQQ 384 Query: 871 XXXSXPXPPS 900 + P PPS Sbjct: 385 YYNAPPTPPS 394 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 30.3 bits (65), Expect = 2.1 Identities = 31/107 (28%), Positives = 33/107 (30%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGR 722 G G GG G G G GGG GG G G G GG Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGAS-----GGGPGGASGGGP-------GGASGGGP 196 Query: 721 GGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXGXGXRSGXPPRPXXG 581 GG GG +P E PG G G G + G P G Sbjct: 197 GGASGGASGDKP-----EGAPGDKPGGAWGGK-PGKKPGHKPEGARG 237 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -3 Query: 896 GGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG 717 G G + G G GG K GG GGG GG G Sbjct: 114 GASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASG 173 Query: 716 XXGGGG 699 GGG Sbjct: 174 GASGGG 179 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.3 bits (65), Expect = 2.1 Identities = 23/100 (23%), Positives = 25/100 (25%), Gaps = 3/100 (3%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXP---PPPPPPXXXXXXXXPPPXPPRHXXPPX 867 PPP P P P V + PPP P PP P H P Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKK 297 Query: 868 SXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 PP P P P + P P Sbjct: 298 PCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPP 337 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXRPXXPXXEXXPGAXXGAXXXGXG 623 GGG GG G G G GGRGG G G G G G G Sbjct: 9 GGGFSGGRGRG-GYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRG 67 Query: 622 XGXRSG 605 R G Sbjct: 68 PAGRGG 73 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP P P + PPPP PP PP + P Sbjct: 671 PPPP--PCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPP-PPSYYSPSPKVEY 727 Query: 880 SXPXPPS 900 P PPS Sbjct: 728 KSPPPPS 734 Score = 28.7 bits (61), Expect = 6.3 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 8/80 (10%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPP---PPXXXXXXXXPPPX-----PPRHXX 858 PPP P P PPPPP P PPP PP + Sbjct: 646 PPP--PYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYS 703 Query: 859 PPXSXXXSXPXPPSXLXXAP 918 P P PPS +P Sbjct: 704 PSPKVYYKSPPPPSYYSPSP 723 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPPPPP P PP PP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P P PP A P PP PP PP PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPP 691 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPP 846 PPPPP P PPP PP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPP 74 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 G G GGG G G G GG G GG G Sbjct: 29 GSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GGG GGG G G GG GG G G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSG 49 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 869 PXPPXPPXPPPXSPP 913 P PP PP PPP PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPPPXPPR 849 F PPPPPPP PPP PP+ Sbjct: 244 FLAPPPPPPPPP--------PPPPPPQ 262 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 785 PPXPPP---PXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PP P PP P P PP PP SPP Sbjct: 142 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 187 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP P P PP PP +PP Sbjct: 175 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP A P P PP PP PP Sbjct: 179 PVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP P P PP PP PP Sbjct: 79 PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP P P PP PP PP Sbjct: 103 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP P P PP PP PP Sbjct: 151 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +2 Query: 788 PXPPP---PXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP P PP P P PP PP SPP Sbjct: 71 PVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 115 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = -1 Query: 889 GGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXG---GGXGXGXXXXXXXGGXXXXGGRG 719 GG G G G G G G GG G G GG GG G Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Query: 718 GXXGGV 701 G GG+ Sbjct: 102 GGLGGL 107 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PPPP P+ PPPP P PPP PP Sbjct: 233 PPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXP-----PXPPP 901 PP PPPP A + P PP P P PPP Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPP 237 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 875 PPXPPXPPPXSPP 913 PP PP PPP SPP Sbjct: 79 PPSPPPPPPPSPP 91 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 869 PXPPXPPXPPPXSPP 913 P PP PP P P S P Sbjct: 80 PSPPPPPPPSPPSEP 94 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 785 PPXPPPPXXP 814 PP PPPP P Sbjct: 79 PPSPPPPPPP 88 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPPP P PP PP PP S P P + P P S P P Sbjct: 65 PPPPSP------QYSPPPPPSQSSPPRS--RCPPVPTTGCCNQPPGPPPSTMYSPPYP 114 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXP--PPXSPP 913 P PPP PP + P P P PP P PP P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVP 155 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 785 PPXPP--PPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP PP P P PP PP PP Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPP 68 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRG---XXGGGG 699 GG W GGG K GGGG + GG RG GGGG Sbjct: 1286 GGSSWGKQDGGGGGSSWGKQNDGGGGSSWGKQGDGGSKPWNEHSGGGRGFGERRGGGG 1343 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXK-----XXTXXARXXXXXGGXR-GXXGGG 702 GG W GGG K GGGG G K + + GG G GG Sbjct: 1237 GGSSWGKQDGGGGGSSWGKQDGGGGSGSAWGKQNETSNGSSWGKQNDSGGGSSWGKQDGG 1296 Query: 701 GG 696 GG Sbjct: 1297 GG 1298 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 799 GGXGGGXGXGXXXXXXXGGXXXXGGRGGXXGGVG 698 GG GGG G G GG GG GG GG G Sbjct: 71 GGGGGGRGYGGGGRREGGG--YGGGDGGSYGGGG 102 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +1 Query: 784 PPPPPPPXXXXXXXX---PPPXPPRHXXPPXSXXXSXPXPPSXL 906 P PPPP PPP PP P P PPS + Sbjct: 138 PSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPPPSKI 181 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PPPPP PP V + PPPP P Sbjct: 29 PPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYP 64 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 802 GGGXGGGXGXGXXXXXXXGGXXXXGGRGGXXG 707 GGG GGG G G G GG+ G G Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/73 (32%), Positives = 26/73 (35%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXX 738 GA +GG G + GG G GGG K GGGGGG K Sbjct: 273 GAGGGAKGGPGNQ---NQGG----GKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAG 325 Query: 737 XXGGXRGXXGGGG 699 G GGGG Sbjct: 326 GVSGGFRPMGGGG 338 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPPPPP PP PP S P P+ Sbjct: 124 PPPPPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPPTPA 161 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PPP P +T P P PP PP P P Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPP-PPASLPTFP 127 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 29.9 bits (64), Expect = 2.7 Identities = 23/89 (25%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS--X 873 P P P PP + P PPPP PP P +H S Sbjct: 18 PYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPPPHQHTSGSHSGPL 77 Query: 874 XXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 S PS L AP P+P Sbjct: 78 DYSHNPQPSSLAAAPPEYHRHSFDYQPSP 106 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 785 PPXPPPPXX--PPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PP P P ++ P P PP PP PPP P Sbjct: 230 PPTPPLPKFLVSPASSLGKRDENSSPFAP-PTPPPPPPPPPPRP 272 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +2 Query: 794 PPPPXXPPXXXXXXXXXXATRXXPXPX-PPXPPXPPPXSPP 913 PP P P P PP PP PPP PP Sbjct: 230 PPTPPLPKFLVSPASSLGKRDENSSPFAPPTPPPPPPPPPP 270 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 784 PPPPPPP--XXXXXXXXPPPXPPRHXXPP 864 PPPPPPP PPP PP P Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPPPSFHAQP 250 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXS--XXXSXPXPPS 900 PPPPP P PP P H P P PPS Sbjct: 54 PPPPPHPAYSRPVALPPTLPIPHPSPHAERFYYRQSPPPPS 94 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPX--PPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 P P P PPP PP PP + + PP AP P S PA Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPS-PADV 82 Query: 964 AXLXXPRP 987 P P Sbjct: 83 PTASPPAP 90 >At5g01170.1 68418.m00021 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 568 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = -3 Query: 899 EGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXR 720 EGG G + WR GG + G T R GG Sbjct: 477 EGG-GPKMRRSNSNVSWRSSGGGSARNKSSRYSSKDGENGMLRFYLTPMRRSWKTSGGSG 535 Query: 719 GXXGGGGG 696 G GGGGG Sbjct: 536 GGGGGGGG 543 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 P PP PP + P P PP PP SP Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSP 72 Score = 28.3 bits (60), Expect = 8.3 Identities = 21/89 (23%), Positives = 26/89 (29%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPP PP + PP P P P P + PP + Sbjct: 39 PPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPP-APEG 97 Query: 880 SXPXPPSXLXXAPXXXXPXXXXSXPAPXA 966 S P P P P + P+P A Sbjct: 98 STPVTPPAPPQTPSNQSP-ERPTPPSPGA 125 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/68 (26%), Positives = 19/68 (27%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 P PPP P PP PP S P P +P S P P Sbjct: 58 PMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPS 117 Query: 964 AXLXXPRP 987 P P Sbjct: 118 GMESSPSP 125 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPP-PXSPP 913 P P P PP +T P PP PP PP P PP Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTP-SSPPSPPSPPSPSLPP 164 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPR----HXXPPXSXXXSXPXP 894 PPPPPPP P P PPR PP + S P P Sbjct: 193 PPPPPPP--------PTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 785 PPXPPP--PXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PPP P PP + P P PP PP P SP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHS---PSPPPPPPPQWGPPSP 74 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 785 PPXPPP--PXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSP 910 PP PPP P PP + P P PP PP P SP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHS---PSPPPPPPPQWGPPSP 74 >At1g55270.1 68414.m06314 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 4 [Arabidopsis thaliana] GI:10716953; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 434 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Frame = +3 Query: 99 LAIDLLHPSPASERRKHKL--KRL--VPHPNSYFMDVKCPGLLQDYNSF*SRTESGGLRW 266 LA+ L P +E RK +L KR + N ++ K G+ +++ R G + W Sbjct: 86 LAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKISW 145 Query: 267 MLNDPLSTHWWP 302 DP+S W P Sbjct: 146 NTFDPISQLWQP 157 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/73 (27%), Positives = 22/73 (30%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXX 879 PPPP PP A PPPP P P + PP Sbjct: 684 PPPPYVYSSPPPPYYSPAPKPTY---KSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVY 740 Query: 880 SXPXPPSXLXXAP 918 S P PP +P Sbjct: 741 SSPPPPPYYSPSP 753 Score = 28.7 bits (61), Expect = 6.3 Identities = 27/101 (26%), Positives = 29/101 (28%), Gaps = 5/101 (4%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP-----PPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PP + V PPPP PPP P P P PP Sbjct: 157 PPPPYVYSSPPPPYYSPSPKVDY---KSPPPPYVYNSPPPPYYS----PSPKPTYKSPPP 209 Query: 865 XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 S P P P P +P P P Sbjct: 210 PYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSP 250 Score = 28.3 bits (60), Expect = 8.3 Identities = 27/102 (26%), Positives = 28/102 (27%), Gaps = 5/102 (4%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP-----PPPXXXXXXXXPPPXPPRHXXP 861 PPPP PP V PPPP PPP P P P P Sbjct: 307 PPPPYVYSFPPPPYYSPSPKPVYK----SPPPPYVYNSPPPPYYS----PSPKPAYKSPP 358 Query: 862 PXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P S P P P P +P P P Sbjct: 359 PPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 869 PXPPXPPXPPPXSP 910 P PP PP PPP SP Sbjct: 235 PGPPPPPPPPPPSP 248 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 25.0 bits (52), Expect(2) = 4.0 Identities = 14/44 (31%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 785 PPXPP-PPXXPPXXXXXXXXXXATRXXPXPXP-PXPPXPPPXSP 910 PP PP PP PP ++ P P P P P +P Sbjct: 39 PPQPPEPPESPPDLRRPEKSIGSSSSSSSPSPIPSPKTPLKINP 82 Score = 22.6 bits (46), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 884 PPXPPPXSPP 913 PP PPP PP Sbjct: 123 PPPPPPPPPP 132 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 25.0 bits (52), Expect(2) = 4.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 863 PXPXPPXPPXPP 898 P P PP PP PP Sbjct: 60 PSPPPPLPPTPP 71 Score = 22.6 bits (46), Expect(2) = 4.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 785 PPXPPPPXXP 814 PP PPPP P Sbjct: 59 PPSPPPPLPP 68 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +1 Query: 784 PPP----PPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSX 951 PPP PPPP PPP + PP PP P P Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKT-YPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKY 127 Query: 952 PAP 960 P P Sbjct: 128 PPP 130 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPP 837 PPPPPPP PPP Sbjct: 137 PPPPPPPPRSPNSASPPP 154 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 869 PXPPXPPXPPPXSPP 913 P PP PP PP SPP Sbjct: 225 PPPPPPPSPPQSSPP 239 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP P SPP Sbjct: 226 PPPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 869 PXPPXPPXPPPXSPP 913 P PP PP PP SPP Sbjct: 225 PPPPPPPSPPQSSPP 239 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP P SPP Sbjct: 226 PPPPPPSPPQSSPPSPP 242 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 851 WRGGXGGGXXLXXXKXGGGGGGG 783 W GG GGG GGGGG G Sbjct: 58 WGGGMGGGGGGGGGSGGGGGGRG 80 >At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) identical to WIP2 protein [Arabidopsis thaliana] gi|18027012|gb|AAL55722; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 383 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P P PP PP R PP PP PPP SPP Sbjct: 30 PHPLPPVTPPSSFFFFPQSGDLR-----RPPPPPTPPP-SPP 65 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXGXXRVAXXXXXXXXXXGGXXGGGGXGG 784 GG GGG G GG G GG G G GG Sbjct: 507 GGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGG 549 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/59 (25%), Positives = 17/59 (28%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PPPP P PPP P + P + PP P P P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPP 113 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +1 Query: 706 PPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPP 846 PP P+ PP + PPPPP PPP P Sbjct: 84 PPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPS-KYGKVYPPPPAKP 129 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PPPPP L PP + F P P P P Sbjct: 26 PPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNP 61 Score = 28.7 bits (61), Expect = 6.3 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPPPP PPP P P P P P P P P Sbjct: 23 PPPPPPP--PSSSLPPPPLPTEIQANPIVFAAVTPYPNP--NPNPVYQYPASYYHHPPPG 78 Query: 964 AXLXXP 981 A P Sbjct: 79 AMPLPP 84 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPP 804 PPPPP L PP + F P P P P Sbjct: 26 PPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNP 61 Score = 28.7 bits (61), Expect = 6.3 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPX 963 PPPPPPP PPP P P P P P P P P Sbjct: 23 PPPPPPP--PSSSLPPPPLPTEIQANPIVFAAVTPYPNP--NPNPVYQYPASYYHHPPPG 78 Query: 964 AXLXXP 981 A P Sbjct: 79 AMPLPP 84 >At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 340 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPS 900 PPPPP PP P PP S + P PP+ Sbjct: 196 PPPPPQSLSLSLPSPPQP-----PPSSSFHAEPIPPT 227 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXP 933 P PP PP P PP S P P S AP P Sbjct: 17 PSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNP 64 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.1 bits (62), Expect = 4.8 Identities = 20/73 (27%), Positives = 20/73 (27%), Gaps = 5/73 (6%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXP-----PPXPPRHXXP 861 P PPP P PP PPPP P P PP Sbjct: 12 PAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLPENS 71 Query: 862 PXSXXXSXPXPPS 900 S P PPS Sbjct: 72 SDGSSSSSPPPPS 84 >At1g26110.1 68414.m03186 expressed protein Length = 611 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGG 786 G R GG G RGG GG GGGGGG Sbjct: 551 GEFSRFRGGRGGRGGYGRNNGYSRGGYGGRGYGGYGGRGGGGGG 594 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +2 Query: 788 PXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PPP PP + P PP PPP P Sbjct: 139 PIPPPQHPPPRPQSQPLDYYSAPQGNHYYSPSPPPPPPPQAP 180 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 697 PPPPPXXPLXPP 732 PPPPP P PP Sbjct: 107 PPPPPPKPQPPP 118 Score = 23.0 bits (47), Expect(2) = 4.8 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPP 834 P PPPPP PP Sbjct: 114 PQPPPPPPRSQKPMQPP 130 >At5g25220.1 68418.m02990 homeobox protein knotted-1 like 3 (KNAT3) identical to homeobox protein knotted-1 like 3 (KNAT3) SP:P48000 from [Arabidopsis thaliana] Length = 431 Score = 25.8 bits (54), Expect(2) = 5.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPP 837 PPPPPP PPP Sbjct: 28 PPPPPPQQQQHFQEAPPP 45 Score = 21.4 bits (43), Expect(2) = 5.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 700 PPPPXXPLXPP 732 PPPP P PP Sbjct: 23 PPPPQPPPPPP 33 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPR 849 PPPPPP P P PP+ Sbjct: 349 PPPPPPVIQPELPQPQPPPPQ 369 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXKXXTXXARXXXXXGGXRGXXGGGG 699 GG G G G + GG G G R G RG GGG Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGG 59 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXP 888 P PPPP PPP P+ P S P Sbjct: 88 PQPPPPPPIENLPPPPPPLPKFSPSPIKRAISLP 121 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXP 843 P PPPPP PPP P Sbjct: 88 PQPPPPPPIENLPPPPPPLP 107 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPPRHXXPP 864 PPPP PPP PP PP Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPPP 78 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/111 (25%), Positives = 31/111 (27%), Gaps = 15/111 (13%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXP-----PPPPP-----PXXXXXXXXPP----- 834 PPPP PP + V P PPPPP P PP Sbjct: 662 PPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSS 721 Query: 835 PXPPRHXXPPXSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPRP 987 P PP + P S P P P P +P P P Sbjct: 722 PPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTP 772 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 836 GGGXXLXXXKXGGGGGGG 783 GGG + K GGGGGGG Sbjct: 95 GGGGGIGGDKFGGGGGGG 112 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXP 843 PPPPPP PPP P Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 790 PPPPPXXXXXXXXPPPXPP 846 PPPPP PPP PP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 28.7 bits (61), Expect = 6.3 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +1 Query: 691 GXPPPPPXX--PLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPP 864 G PPPPP PP A PPPP P PP + PP Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPP------NNMGGPRHPPPYGAPP 302 Query: 865 XSXXXSXPXPPSXLXXAP 918 + P PP P Sbjct: 303 QN-NMGGPRPPQNYGGTP 319 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 P PP PP +++ P PP P PPP +PP Sbjct: 263 PSQPPSSQLPPQLPTQF----SSQQEPYCPPPSHPQPPPSNPP 301 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSP 910 P PP PP PPP SP Sbjct: 79 PPTLPPSPPPPPPFSP 94 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 901 GRGXGGXRXXXXGXXXXGXXGXXXXXXXXXXXXGGGXGGGXGXGXXXXXXXGGXXXXGGR 722 G G GG G G G GG GGG G G GG GG Sbjct: 60 GHGHGGHN----GGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGH 115 Query: 721 G 719 G Sbjct: 116 G 116 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPP--XSXXXSXPXPPSXLXXAPXXXXPXXXXSXPAP 960 PP PP PPP P PP S S P PP S P P Sbjct: 65 PPNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPNP 124 Query: 961 XAXLXXP 981 + P Sbjct: 125 PVTVPNP 131 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +1 Query: 769 FXXXXPPPPPPPXXXXXXXXPP--PXPPRH 852 F PPPPPP PP P PP H Sbjct: 74 FHNSLPPPPPPHLLPLSPPLPPLLPLPPPH 103 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 912 GGEXGGGXGGXGGXGXG 862 GG GGG GG GG G G Sbjct: 789 GGHHGGGGGGCGGCGGG 805 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 6.3 Identities = 26/94 (27%), Positives = 29/94 (30%) Frame = +1 Query: 703 PPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXS 882 PPP P+ P V F PPPP PP P+ PP Sbjct: 825 PPPVHPVSQPQ-----GPQVQQFDQLYPPPPL--GHSLPSVLQPPLQPQ-SQPPEPPPEM 876 Query: 883 XPXPPSXLXXAPXXXXPXXXXSXPAPXAXLXXPR 984 P PP L P P P + L PR Sbjct: 877 MPPPPQAL--PPPLPHSHPPLVPPPPFSPLLSPR 908 Score = 28.3 bits (60), Expect = 8.3 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +1 Query: 700 PPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPP--PPPXXXXXXXXPPPXPPRHXXPPXSX 873 PPPP P L PPP PPP P PP PP S Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQP---PEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Query: 874 XXSXPXPP 897 S PP Sbjct: 904 LLSPRLPP 911 >At3g28630.1 68416.m03573 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 335 Score = 24.2 bits (50), Expect(2) = 7.4 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +3 Query: 777 PXPPPXPPPXFXXXQXXXXXXPXXP 851 P PPP PPP + P P Sbjct: 195 PLPPPPPPPELLQVRKDDHQEPNSP 219 Score = 22.6 bits (46), Expect(2) = 7.4 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXP 797 PP P P PPP P Sbjct: 186 PPVAEPAYTPLPPPPPPP 203 >At3g28630.2 68416.m03574 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 303 Score = 24.2 bits (50), Expect(2) = 7.4 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +3 Query: 777 PXPPPXPPPXFXXXQXXXXXXPXXP 851 P PPP PPP + P P Sbjct: 163 PLPPPPPPPELLQVRKDDHQEPNSP 187 Score = 22.6 bits (46), Expect(2) = 7.4 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 744 PPXXXXXXLPXPXPPPXP 797 PP P P PPP P Sbjct: 154 PPVAEPAYTPLPPPPPPP 171 >At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEAFY PETIOLE, putative nearly identical to AP2/EREBP-like transcription factor LEAFY PETIOLE [Arabidopsis thaliana] GI:6942018 Length = 211 Score = 24.6 bits (51), Expect(2) = 7.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 869 PXPPXPPXPPPXSPP 913 P PP PP PP + P Sbjct: 95 PPPPPPPPAPPSNDP 109 Score = 22.2 bits (45), Expect(2) = 7.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 785 PPXPPPPXXPP 817 P PPPP PP Sbjct: 92 PDDPPPPPPPP 102 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +1 Query: 787 PPPPPPXXXXXXXXPPPXPPRHXXPPXS--XXXSXPXPPSXLXXAP 918 PPPPP PPP PP P + P PP + P Sbjct: 121 PPPPPYLVHAVPYHPPPFPPMVPLPHAAGPDFPYAPYPPYPVPVPP 166 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 785 PPXPPPPXXPPXXXXXXXXXXATRXXPXPXPPXPPXPPPXSPP 913 PP PPPP P P P P PP S P Sbjct: 3 PPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLP 45 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 697 PPPPPXXPLXPPXXXXXLAXXVXXFXXXXPPPPPPPXXXXXXXXPPPXPPRHXXPPXS 870 PPPPP P PP A PPPP PP PP S Sbjct: 47 PPPPPSNPSPPPPSPTTTA---------CPPPPSSSGGGPYYYYPPASQSGSYRPPPS 95 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G + GG G RGG GGG GGGG GG Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGG 592 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 917 GAXXRXEGGXGXEXXXEXGGXXWRGGXGGGXXLXXXKXGGGGGGG 783 G + GG G RGG GGG GGGG GG Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGG 592 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 851 TRXXPXPXPPXPPXPPP 901 T P P PP PP PPP Sbjct: 41 TLTPPPPPPPRPPPPPP 57 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 784 PPPPPPPXXXXXXXXPPPXPPRHXXPPXSXXXSXPXP 894 PPPPP PP P PP S P P Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRP 137 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 790 GGGXGXGXXXXXXXGGXXXXGGRGGXXGGVGXXR 689 GGG G G GG GGRG G G R Sbjct: 488 GGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGR 521 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -3 Query: 863 GGXXWRGGXGGGXXLXXXKXGGGGGGGXXXXK--XXTXXARXXXXXGGXRGXXGGG 702 GG GG GGG + GGGGG GG G GGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHTGGGNGSLGGG 120 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 785 PPXPPPPXXPP 817 PP PPPP PP Sbjct: 81 PPQPPPPPPPP 91 Score = 21.0 bits (42), Expect(2) = 9.6 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSP 910 P P PP PP +P Sbjct: 84 PPPPPPPPPPSSSRNP 99 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 25.4 bits (53), Expect(2) = 10.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 785 PPXPPPPXXPP 817 PP PPPP PP Sbjct: 55 PPPPPPPPPPP 65 Score = 21.0 bits (42), Expect(2) = 10.0 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 863 PXPXPPXPPXPPPXSPP 913 P P PP PP S P Sbjct: 58 PPPPPPPPPSENELSGP 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,853,697 Number of Sequences: 28952 Number of extensions: 475819 Number of successful extensions: 14392 Number of sequences better than 10.0: 237 Number of HSP's better than 10.0 without gapping: 1383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5656 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2411911104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -