BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C05 (964 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) 29 4.2 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 28 9.8 >SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) Length = 822 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 160 HVPTRARRQAGSFTVNS---DGTSGAALKVPLTGNDKNVLSAIGSADFNDRHK 309 HVP + G + NS T G+ + +PL ++K V+ +G ND HK Sbjct: 526 HVP-KVGSHGGVYFWNSFRNKDTDGSLIVLPLKDHEKRVIGLLGVDTLNDSHK 577 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 28.3 bits (60), Expect = 9.8 Identities = 19/72 (26%), Positives = 27/72 (37%) Frame = -3 Query: 359 PCPFTLSRASPAEAALSLWRSLKSADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPACL 180 P P L R PA L L+ P S LP+ +P+ ++ P Sbjct: 619 PTPLPLERPVPAVTRLPTHLPLEQPVPAVTSLPTHLPLERPLPDVTRLPTHLPLERPVPA 678 Query: 179 RARVGTCLPLAK 144 R+ T LPL + Sbjct: 679 VTRLPTDLPLER 690 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,430,060 Number of Sequences: 59808 Number of extensions: 345739 Number of successful extensions: 738 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2836293838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -