BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C04 (998 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 29 0.29 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 25 4.7 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 8.2 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 28.7 bits (61), Expect = 0.29 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 637 WGVWAPSCPRETSRLLRHCAHQGLHGXXPSPP 732 W V+ P C +++ ++ C +G + P+PP Sbjct: 608 WAVYQPYCRGKSATMIDGCFEEGENAIVPTPP 639 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 24.6 bits (51), Expect = 4.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 234 ALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNE 362 ++TG ++LK KQ+L +DG + ++ D+ I++ E Sbjct: 575 SVTGTKLLKKTKQQLEPLDGTLGWRRSHRPSLHDISIIDEEEE 617 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 8.2 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 92 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 238 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 964,524 Number of Sequences: 2352 Number of extensions: 20711 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 109763433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -