BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C02 (971 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|... 155 1e-38 SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharo... 27 3.0 SPBC800.08 |gcd10||translation initiation factor eIF-3 gamma sub... 26 9.2 SPBC216.03 |||conserved fungal protein|Schizosaccharomyces pombe... 26 9.2 SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharom... 26 9.2 SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex ... 26 9.2 >SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|||Manual Length = 512 Score = 155 bits (375), Expect = 1e-38 Identities = 69/112 (61%), Positives = 83/112 (74%) Frame = +1 Query: 244 AIQTVGKNGPALLQDVNFLDEMSSFDRERIPERVVHAKGAGAFGYFEVTHDITKYSAAKV 423 A VGK GP LLQD + +D FDRERIPERVVHAKG+GAFG FE T DITKY+ + Sbjct: 25 AAARVGKGGPVLLQDSHLIDVFQHFDRERIPERVVHAKGSGAFGEFECTDDITKYTKHTM 84 Query: 424 FESIGKRTPIAVRFSTVGGESGSADTVRDPRGFAVXFYTDDGVWDXLGXTXP 579 F +GK+TP+ RFSTVGGE G+ DT RDPRGFA+ FYTD+G++D +G P Sbjct: 85 FSKVGKKTPMVARFSTVGGERGTPDTARDPRGFALKFYTDEGIFDMVGNNTP 136 >SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1388 Score = 27.5 bits (58), Expect = 3.0 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 526 QQNLEGHEQYQQIHSLHQLLRI*QQSVSFCL-WTQILWQHCTW 401 ++ E +E+Y+Q+ + SV + + W Q+L+ CTW Sbjct: 278 ERKRENYEEYKQVDRIVAKHLNSDGSVEYLVKWKQLLYDFCTW 320 >SPBC800.08 |gcd10||translation initiation factor eIF-3 gamma subunit Gcd10|Schizosaccharomyces pombe|chr 2|||Manual Length = 462 Score = 25.8 bits (54), Expect = 9.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 149 LGLLKPFCMFPSYYAAFVV*YHGATHW 69 LG+ +PF ++ +Y V YH + W Sbjct: 334 LGISRPFMVYSTYQQVLVETYHQLSKW 360 >SPBC216.03 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 247 Score = 25.8 bits (54), Expect = 9.2 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 301 DEMSSFDRERIPERVVHAKGAGAFGYFEVTHDITKYSAAKVFESI 435 ++++ F E P+ V+ A GAG G E T + A KV++++ Sbjct: 59 NDIAQFLAEIHPDVVIFAAGAGGKGGPERTRAVDYEGAIKVYDAM 103 >SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 25.8 bits (54), Expect = 9.2 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -1 Query: 467 ENLTAIGVLLPMDSNTLAALYLVMS*VTSKYPKAPAPLACTTRSGIRSLSKDDIS 303 + + I L SNT A S V + Y K+P +A T R I+S +K IS Sbjct: 294 DTVDIIRALKEYASNTSALAEFAKSTVKTLYSKSPTSIAVTNRL-IKSAAKWSIS 347 >SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex subunit Apc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 500 VSADPLSPPTVENLTAIGVLLPMDSNTL 417 VS +P + +NLTAIGV P+D+N + Sbjct: 142 VSINPYNFSAFQNLTAIGV--PLDANNV 167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,946,576 Number of Sequences: 5004 Number of extensions: 51519 Number of successful extensions: 120 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 499296500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -