BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C02 (971 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48124| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 30 2.5 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 30 3.3 SB_20470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_48124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 30.7 bits (66), Expect = 1.9 Identities = 30/85 (35%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = -1 Query: 485 LSPPTVENLTAIGVLLPMDSNTLAAL------YLVMS*VTSKYPKAPAPLACTTRSGIRS 324 LSP TV NLT V P+ +N LA + Y+V SK + C T + Sbjct: 154 LSPLTV-NLTGSCVSGPIRTNDLALITCPSEKYIVKQSALSKCFQNDKAFLCPTNILHKI 212 Query: 323 LSKDDISSRKLTSCNKAGPFLPTVC 249 S D + KLT A FLPT C Sbjct: 213 GSFDWLGHTKLTKLKYARNFLPTSC 237 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 241 TAIQTVGKNGPALLQDVNFLDEMSSFDRERIPERVVHAKGAGAFGYFEVTHDITKYSAAK 420 T + T ++GP + + S R+R+ E + G G + Y +IT+YS ++ Sbjct: 177 TQVSTTRRSGPDGKTTTTTREVVDSGGRQRVTESTRTSPGIGRYDYTSARRNITEYSPSQ 236 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.9 bits (64), Expect = 3.3 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 2/91 (2%) Frame = +1 Query: 394 DITKYSAAKVFESIGKRTPIAVRFSTVGGESGSADTV--RDPRGFAVXFYTDDGVWDXLG 567 ++T + V ES G P V +S S + + DPR F+ +DG + +G Sbjct: 405 NLTGGANQNVSESPGVEEPSDVTWSYEKSLSDTCQAIPKHDPRLFS---QDEDGDTEGVG 461 Query: 568 XTXPPPXSX*XXPXXSPXFXPXPXKXTPXQP 660 PPP P P P P P P Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 >SB_20470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.5 bits (63), Expect = 4.3 Identities = 21/86 (24%), Positives = 32/86 (37%), Gaps = 6/86 (6%) Frame = +1 Query: 256 VGKNGPALLQDVNFLDEMSSFDRERIPERVVH------AKGAGAFGYFEVTHDITKYSAA 417 + N LLQ + F +M F ++ R +H +KG YF DI + + Sbjct: 258 ITSNAMGLLQSLTFFTQMRFFCHKQAVGRTLHILTTPDSKGKAVVDYFSAKTDILPSACS 317 Query: 418 KVFESIGKRTPIAVRFSTVGGESGSA 495 E G + R G +S A Sbjct: 318 SFTEGAGNNALLTGRCHRWGRDSSGA 343 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,794,154 Number of Sequences: 59808 Number of extensions: 405726 Number of successful extensions: 877 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -