BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C02 (971 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 26 0.59 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 2.4 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 25.8 bits (54), Expect = 0.59 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 544 HQYRTXQQNLEGHEQYQQIHSLHQLLRI*QQS 449 HQ + QQ+L+ HEQ+ Q QQS Sbjct: 186 HQSQAQQQHLQAHEQHMMYQQQQQSQAASQQS 217 Score = 22.6 bits (46), Expect = 5.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 547 HHQYRTXQQNLEGHEQYQQIHSLHQLLRI*QQS 449 H Q + Q + +Q+ Q H H + + QQS Sbjct: 178 HMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQS 210 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 2.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 143 DPATDQLINYKKTLKDSPGFHHH*IWSSXLESKRRYK 253 DP D + Y LK+ P + H W++ L +R K Sbjct: 440 DPNGDYIRRYLPVLKNFPTRYIHEPWNAPLNVQRAAK 476 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,845 Number of Sequences: 438 Number of extensions: 4214 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32048835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -