BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B23 (1060 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 37 0.024 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.22 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 34 0.22 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.29 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.51 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.51 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.2 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 31 2.1 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 2.1 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 29 4.8 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 29 4.8 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 6.3 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 8.3 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 8.3 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 8.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 8.3 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 8.3 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 8.3 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/77 (31%), Positives = 27/77 (35%) Frame = +2 Query: 476 TDPXSXSXXGGNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXK 655 ++ S S GG+ PP P PG A PP P G P A PP AP Sbjct: 907 SESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Query: 656 RNPSIXQXPTXPXGXTP 706 P P G P Sbjct: 967 -GGGAPPLPPPPGGSAP 982 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = +2 Query: 503 GGNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXP 682 GG+ +P PG PP P G P P A PP AP P P Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 683 TXPXGXTP 706 P G P Sbjct: 965 -PPGGGAP 971 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 585 PPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPP 719 PP A PP G APP P S PP A P PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = +2 Query: 482 PXSXSXXGGNTAPPHPIPGTXARKX-------PPXPXGXXTPPXP 595 P GGN PP P PG A PP P G PP P Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP P + PP G APP P S PP P PPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAP---PPGGGAPPLPPPPGGSAPPP--PPPPPPPPPP 994 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P + PP P P P Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +1 Query: 775 PPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSXAPXPXXPLXPP 954 PPP S P PPPP P P P + P P P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 955 PXLXXTXXP 981 P L P Sbjct: 432 PALRLACAP 440 Score = 35.9 bits (79), Expect = 0.055 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP + P P P PP P P PP P P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 35.5 bits (78), Expect = 0.073 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 775 PPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSXAPXPXXPLXPP 954 PPP P PPPP P P P AP P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 955 P 957 P Sbjct: 430 P 430 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P +P PP P PP P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P + P P PP P P PP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 872 PPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PP P P P PP P P+ PP P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 872 PPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PP P P P PP P P PP P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXPXQL 994 PPP P P P PP P P PP P P P L Sbjct: 395 PPPPP--PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P P P P PP P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P P PP P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P P PP P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P P PP P P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P P P P P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP P PP PP P PP A P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/63 (26%), Positives = 19/63 (30%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 PP P P + PP P PP P PP P P+ P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 698 XTP 706 P Sbjct: 430 PPP 432 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P + PP P PP PP P PP P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP P PP PP P PP P PPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +3 Query: 567 PXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P PP P PP PP + P PP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 PP P P PP P +PP P PP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 698 XTP 706 P Sbjct: 427 PPP 429 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 775 PPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSXAPXPXXPLXPP 954 PPP P PPPP P P P P P P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP-PPPPPPPPPPPPPPPPAPPPPPP 425 Query: 955 P 957 P Sbjct: 426 P 426 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 PP P P + PP P PP P PP P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 698 XTP 706 P Sbjct: 428 PPP 430 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP P PP PP P PP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP P PP PP P PP P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/51 (27%), Positives = 17/51 (33%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSI 670 PP P P + PP P PP P PP P P++ Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P P PP P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PP P P P PP P P P P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 482 PXSXSXXGGNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPP 631 P G PP P+PG A PP G PP P G V P Sbjct: 667 PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFANLVKP 716 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +2 Query: 506 GNTAPPHPIPGTXA-----RKXPPXPXGXXTPPXPSTXXGAXXXVPP 631 G PP P PG A PP P G PP P GA PP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.9 bits (74), Expect = 0.22 Identities = 21/70 (30%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = +2 Query: 512 TAPPHPIPGTXARKXPPXPXGXXTPP-----XPSTXXGAXXXVPPXXXRAPXKRNPSIXQ 676 TAPP P P +++ PP G PP P A PP P P I Sbjct: 324 TAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEG 383 Query: 677 XPTXPXGXTP 706 P G P Sbjct: 384 RPPSSLGNPP 393 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 515 APPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPX 694 APP P G PP P PP P G PP + PS P Sbjct: 296 APPPPSRGAP----PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSM 351 Query: 695 GXTP 706 G P Sbjct: 352 GMAP 355 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXP-PXXSXXPXPXP 985 PPP P P P PP P PS P P + P P P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P R P +P PP P PP P P P Sbjct: 204 PPPP-----PPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXP-XGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXP 691 PP P P A PP P PP P+ A PP P P+ P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.5 bits (63), Expect = 4.8 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXX-PPHQXAXPXQXP---PPH 725 P P P P A PP APP P PP A P P PPH Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Query: 726 LLSF 737 L F Sbjct: 112 FLPF 115 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +2 Query: 506 GNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAP 649 G+ PP P PG + PP P G PP P+ G + P P Sbjct: 107 GDMGPPGP-PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGP 153 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 521 PHPIPGTXARKXPPXPXGXXTPPX-PSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 P+ +PG PP P G PP P PP AP + P P P G Sbjct: 175 PNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPG 234 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 521 PHPIPGTXARKXPPXPXGXXTPP-XPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 P+ +PG PP P G PP P PP AP + P P P G Sbjct: 260 PNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPG 319 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = +2 Query: 521 PHPIPGTXARKXPPXPXGXXTPP-XPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 P+ PG PP P G PP P PP AP + P P P G Sbjct: 345 PNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPG 404 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +2 Query: 506 GNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPT 685 G PP +PG PP P G PP P G + P P P Sbjct: 872 GEMGPPG-LPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPA 930 Query: 686 XP 691 P Sbjct: 931 PP 932 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXPXQ 991 PPP P P P P P P PP P P Q Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQ 78 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 521 PHPIPGTXARKXPPXPXGXXTPP-XPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 P+ PG PP P G PP P PP AP P P P G Sbjct: 430 PNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPG 489 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 521 PHPIPGTXARKXPPXPXGXXTPP-XPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 P+ PG PP P G PP P PP AP P P P G Sbjct: 515 PNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPG 574 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 506 GNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAP 649 G PP +PG PP P G PP P+ G + P P Sbjct: 702 GEMGPPG-LPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 515 APPHPIPGTXARKXPPXPXGXXTPPXPSTXXG 610 +PP P PG K PP P G PP S G Sbjct: 635 SPPGP-PGPPGPKGPPGPNGPLGPPGESGPAG 665 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 506 GNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAP 649 G PP +PG PP P G PP P G + P P Sbjct: 787 GEMGPPG-LPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXP 979 PPP P P P PP P P PP P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXP-PXXSXXPXPXP 985 PPP P P P PP P P+ P P P P P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 133 PPPPNAPYPPS--PNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +3 Query: 555 NPRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPPH 725 NP P A PP P + PP PP P P P PP+ Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 872 PPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXP 979 PP P P P PP P P PP + P P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXP 979 PPP P P P PP P P+ PP P P Sbjct: 180 PPPPNPPYPPP--PNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXP 979 PPP P P PP P P PP P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 555 NPRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPPH 725 NP P PP P A PP PP P PP P PPP+ Sbjct: 184 NPPYPPPP-NPPYPPPPNAPN-PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPN 238 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P PP + P P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPPH 725 P P A PP P + PP PP P PP P PP+ Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPP-NPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Score = 28.7 bits (61), Expect = 8.3 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +1 Query: 640 PRPPQEKSLNXPXPHXTXWPNPXXXXXXXXXXXXXXXXXXXXXXXPPPSXSTXXPHPPPP 819 P PP N P P PNP PPP + P+PPPP Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY-----PPPPNAPNPPYPPPP 237 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P PP P P PP P P P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYP-PPPNAPNPPYPPP 225 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 896 PXRXPXTPXPPXPXXPSXPPXXSXXPXPXPXQL 994 P P P PP P P PP P P P L Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHL 499 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 896 PXRXPXTPXPPXPXXPSXPPXXSXXPXPXPXQL 994 P P P PP P P PP P P P L Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 896 PXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 P P P PP P P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPP 955 PPP P P P PP P P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPP 955 PPP P P P PP P P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/63 (30%), Positives = 21/63 (33%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 PP +P RK P P PP VPP P NP+ PT P Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA---HPTEPPP 1106 Query: 698 XTP 706 P Sbjct: 1107 RQP 1109 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +3 Query: 558 PRXPXAXXRPPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 P P PP QP PP P P+ PP + A P + PPP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPP--PRKPSPPPSEPAPPPRQPPP 1078 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P P P+ PP P P P Sbjct: 1077 PPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXP-PXPXXPSXPPXXSXXPXPXPXQ 991 PPP P R P P P P PP + P P P Q Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQ 1090 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/64 (29%), Positives = 21/64 (32%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXKRNPSIXQXPTXPXG 697 PP P P T PP P PP P T G PP P + P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPT-NGPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 412 Query: 698 XTPT 709 P+ Sbjct: 413 GPPS 416 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/70 (27%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +1 Query: 775 PPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSXAPXPXXPL-XP 951 PPP + P PPPP P P P + P P P P Sbjct: 346 PPPPPTNNPPSPPPPTN-NTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Query: 952 PPXLXXTXXP 981 PP T P Sbjct: 405 PPPPPPTNGP 414 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P +P PP P PP + P P P Sbjct: 346 PPPP-----PTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P PP + P P P Sbjct: 374 PPPPP---PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P PP + P P P Sbjct: 365 PPPPP----PTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 28.7 bits (61), Expect = 8.3 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 775 PPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSXAPXPXXPLXPP 954 PPP T P PPPP G P P P + P P P P Sbjct: 365 PPPPPPTNKPPPPPPPTNG----------PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Query: 955 P 957 P Sbjct: 415 P 415 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPS----XPPXXSXXPXPXP 985 PPP P P T PP P P+ PP + P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXPXP 985 P P PP P P PP S P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXPXP 985 P P PP P P PP P P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 482 PXSXSXXGGNTAPPHPIPGTXARKXPPXPXGXXTPPXP 595 P + G PP P G+ PP P G PP P Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPP 318 Score = 28.7 bits (61), Expect = 8.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 482 PXSXSXXGGNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPP 631 P G APP P P A PP P PP P GA PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPP-----PPPPPGDGGAPPPPPP 336 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPX----PPXPXXPSXPPXXSXXPXPXP 985 PPP P P P PP P P PP P P P Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 984 GWGXGXXEXXGGXEGXXGXGGXGVXGXLXGXXXYXXGGG 868 G+G G GG G G GG G G G + GGG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXP 979 P TP PP P P PP + P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRP 1598 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 29.5 bits (63), Expect = 4.8 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = -3 Query: 1007 GXVXGVXGXGXXVXXRXGGGXRGXXGXGAXEXGXXFXXXXXIXXGAGXXXXXXXXXXXGP 828 G G G G GGG G G G G + G G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Query: 827 XXXGGGGWGXXVEXEGGG 774 GGGG G GGG Sbjct: 855 GGGGGGGGGGGGGGGGGG 872 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.5 bits (63), Expect = 4.8 Identities = 33/132 (25%), Positives = 38/132 (28%), Gaps = 1/132 (0%) Frame = +1 Query: 565 PXGXQXAPXPFNXXXRXXGRXPXXAPRPPQEKSLNXPXPHXTXWPNPXXXXXXXXXXXXX 744 P G + AP P + P PR P+ S P P P P Sbjct: 90 PAGVE-APTPTPMVAQSVAPTPPPPPRAPETPS-QAPSPP----PPPTSPATRAPPPPPP 143 Query: 745 XXXXXXXXXXPPP-SXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXKXXPXSX 921 PPP + +T P PPPP PAP P Sbjct: 144 IAPATGGPPPPPPIAPATGGPPPPPPIAPAATV---------PAPAVPLAAASPPPPSGG 194 Query: 922 APXPXXPLXPPP 957 P P P PPP Sbjct: 195 PPPPPPPPPPPP 206 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 585 PPXLQPXXAXXWXXPPXGXAPPXREIPQXSXXPPHQXAXPXQXPPP 722 PP L P PP G PP R PQ PP P PPP Sbjct: 212 PPGLMPPPGML---PPPGGMPPGRMPPQGLPFPP-----PGPIPPP 249 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXPXP 985 P TP P P P+ PP P P P Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPP 920 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 984 GWGXGXXEXXGGXEGXXGXGGXGVXGXLXGXXXYXXGGG 868 G+G G G G G GG G G G Y GGG Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 4/74 (5%) Frame = +2 Query: 476 TDPXSXSXXGGNTAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGAXXXVPPXXXRAPXK 655 T P S G TAP PG+ A G + P+ +PP AP Sbjct: 443 TTPQSVIPPGKTTAPTTKPPGSPAGSTQGPTDGVLSAKPPTKKTTPQSMIPPGKPTAPTP 502 Query: 656 RNP----SIXQXPT 685 + P + Q PT Sbjct: 503 KPPGSPVGVTQGPT 516 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 869 PPPXK*XXXPXRXPXTPXPPXPXXPSXPPXXSXXPXPXP 985 PPP P + P P PP P PP P P P Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPR-MQPPGPPGPPGPPGPQP 1291 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.7 bits (61), Expect = 8.3 Identities = 32/140 (22%), Positives = 35/140 (25%), Gaps = 7/140 (5%) Frame = +1 Query: 559 PXPXGXQXAPXPFNXXXRXXGRXPXX--APRPPQEKSLNXPXPHXTXWPNPXXXXXXXXX 732 P P + P P G P AP PP+ S N P P P Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP-----PTRGPPSNSFTT 295 Query: 733 XXXXXXXXXXXXXXPPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXK--- 903 PPP + P PPP P P I Sbjct: 296 QGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRS 355 Query: 904 --XXPXSXAPXPXXPLXPPP 957 P AP P PPP Sbjct: 356 APPPPPGRAPQPLGGPPPPP 375 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 8.3 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 5/71 (7%) Frame = +2 Query: 509 NTAPPHPIPGTXARKXPPXPXGXXTPPXPST-XXGAXXXVPPXXXR---APXKRNPS-IX 673 +T P P P A PP P TPP P T +PP P NPS Sbjct: 183 STIPTPPTP--PAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAI 240 Query: 674 QXPTXPXGXTP 706 P P TP Sbjct: 241 ATPNPPMPETP 251 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 512 TAPPHPIPGTXARKXPPXPXGXXTPPXPSTXXGA 613 + PP P PG PP P PP P G+ Sbjct: 193 SVPPPPPPGPGGIPPPPPPIRGGVPPPPPMGGGS 226 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 518 PPHPIPGTXARKXPPXPXGXXTPPXPSTXXG 610 PP P PG PP P PP P+ G Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect = 8.3 Identities = 32/140 (22%), Positives = 35/140 (25%), Gaps = 7/140 (5%) Frame = +1 Query: 559 PXPXGXQXAPXPFNXXXRXXGRXPXX--APRPPQEKSLNXPXPHXTXWPNPXXXXXXXXX 732 P P + P P G P AP PP+ S N P P P Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP-----PTRGPPSNSFTT 207 Query: 733 XXXXXXXXXXXXXXPPPSXSTXXPHPPPPXXXGXXXXXXXXXXXXPAPXXIXXXXXK--- 903 PPP + P PPP P P I Sbjct: 208 QGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRS 267 Query: 904 --XXPXSXAPXPXXPLXPPP 957 P AP P PPP Sbjct: 268 APPPPPGRAPQPLGGPPPPP 287 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXP 979 P P PP P PS PP P P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 917 PXPPXPXXPSXPPXXSXXPXPXP 985 P PP P P+ PP + P P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPP 245 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 908 PXTPXPPXPXXPSXPPXXSXXPXPXP 985 P TP PP P P P P P P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPP 365 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,117,064 Number of Sequences: 59808 Number of extensions: 183912 Number of successful extensions: 2042 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1403 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3189638717 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -