BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B19 (954 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 93 3e-19 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 83 3e-16 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 79 4e-15 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 79 5e-15 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 67 2e-11 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 64 2e-10 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 62 5e-10 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 61 1e-09 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 60 2e-09 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 59 5e-09 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 59 6e-09 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 58 8e-09 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 57 2e-08 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 57 2e-08 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 56 6e-08 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 54 2e-07 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 52 5e-07 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 51 1e-06 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 51 1e-06 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 51 2e-06 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 50 3e-06 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 50 3e-06 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 50 4e-06 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 49 5e-06 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 49 6e-06 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 48 8e-06 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 1e-05 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 48 1e-05 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 48 1e-05 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 47 2e-05 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 47 2e-05 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 47 3e-05 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 47 3e-05 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 46 3e-05 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 46 5e-05 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 46 5e-05 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 46 5e-05 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 45 1e-04 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 45 1e-04 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 44 1e-04 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 44 2e-04 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 44 2e-04 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 43 3e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 43 3e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 43 3e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 43 3e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 43 3e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 43 3e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 43 3e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 43 3e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 43 3e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 43 3e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 43 3e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 43 3e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 43 3e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 43 3e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 43 3e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 43 3e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 43 3e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 43 3e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 43 3e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 43 3e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 43 3e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 43 3e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 43 3e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 43 3e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 43 3e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 43 3e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 43 3e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 43 3e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 43 3e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 43 3e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 43 3e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 43 3e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 43 3e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 43 3e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 43 3e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 43 3e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 43 3e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 43 3e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 43 3e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 43 3e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 43 3e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 43 3e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 43 3e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 43 3e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 43 3e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 43 3e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 43 3e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 43 3e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 43 3e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 43 3e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 43 3e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 43 3e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 43 3e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 43 3e-04 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 43 3e-04 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 43 3e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 43 3e-04 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 43 3e-04 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 43 3e-04 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 43 3e-04 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 43 3e-04 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 43 3e-04 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 43 3e-04 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 43 3e-04 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 43 3e-04 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 43 3e-04 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 43 3e-04 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 43 3e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 43 3e-04 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 43 3e-04 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 43 3e-04 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 43 3e-04 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 43 3e-04 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 43 3e-04 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 43 3e-04 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 43 3e-04 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 43 3e-04 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 43 3e-04 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 43 3e-04 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 43 3e-04 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 93.1 bits (221), Expect = 3e-19 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 304 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYXLXQRR 435 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERY L QRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 93.1 bits (221), Expect = 3e-19 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 304 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYXLXQRR 435 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERY L QRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 83.0 bits (196), Expect = 3e-16 Identities = 32/60 (53%), Positives = 32/60 (53%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P P P PPPPP PP P PPP PP PPPP P P P P PPPPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 80.6 bits (190), Expect = 2e-15 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPP-PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPX 951 PP P S P P PPP PP PP P PPP PP PPPP P P P P PPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 952 P 954 P Sbjct: 428 P 428 Score = 79.8 bits (188), Expect = 3e-15 Identities = 32/66 (48%), Positives = 32/66 (48%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXX 930 P P PP P P P PP PP PP P PPP PP PPPP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 931 XPPPPP 948 PPPPP Sbjct: 427 PPPPPP 432 Score = 79.8 bits (188), Expect = 3e-15 Identities = 31/60 (51%), Positives = 31/60 (51%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P P P PPPP PP P PPP PP PPPP P P P P PPPPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 79.0 bits (186), Expect = 5e-15 Identities = 32/68 (47%), Positives = 32/68 (47%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXX 930 P P PP P P PPPP PP P PPP PP PPPP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 931 XPPPPPXP 954 PPPPP P Sbjct: 425 PPPPPPPP 432 Score = 77.8 bits (183), Expect = 1e-14 Identities = 33/70 (47%), Positives = 33/70 (47%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P PP P PP P P PP PP PP P PP PP PPPPP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP--PAPPP 422 Query: 918 XPXXXXPPPP 947 P PPPP Sbjct: 423 PPPPPPPPPP 432 Score = 72.5 bits (170), Expect = 5e-13 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = +1 Query: 802 SXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 S P P PPPPP PP P PPP P PPP P P P P PPPPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 72.1 bits (169), Expect = 6e-13 Identities = 31/76 (40%), Positives = 31/76 (40%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P P P PP P P PP PP PP P PP PP PPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 900 XPXPPPXPXXXXPPPP 947 P PPP PP Sbjct: 426 PPPPPPPALRLACAPP 441 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 79.4 bits (187), Expect = 4e-15 Identities = 44/75 (58%), Positives = 46/75 (61%) Frame = +1 Query: 451 QNQGITQERTCEQKASKGQEP*KXXXXXXXXXXXXXLTSXTKIDAQVXGGETRXDYKDTR 630 +NQGITQERTCEQKASK K LTS TKIDAQV GGETR DYKDTR Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 631 RXPXXLPRALSCSXL 675 R P P SC+ L Sbjct: 174 RFPLEAP---SCALL 185 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/62 (46%), Positives = 31/62 (50%) Frame = +3 Query: 489 KGQQRPGTVKRPRXWRXSIGSAPPDEXHKNRRSSXRWRNPTGL*RYQAXPLXXPSCALLF 668 K +RPGTVKRPR WR SIGSAP K + PL PSCALLF Sbjct: 127 KASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLF 186 Query: 669 XP 674 P Sbjct: 187 RP 188 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 79.0 bits (186), Expect = 5e-15 Identities = 44/74 (59%), Positives = 45/74 (60%) Frame = +1 Query: 454 NQGITQERTCEQKASKGQEP*KXXXXXXXXXXXXXLTSXTKIDAQVXGGETRXDYKDTRR 633 NQGITQERTCEQKASK K LTS TKIDAQV GGETR DYKDTRR Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 634 XPXXLPRALSCSXL 675 P P SC+ L Sbjct: 146 FPLEAP---SCALL 156 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/62 (46%), Positives = 31/62 (50%) Frame = +3 Query: 489 KGQQRPGTVKRPRXWRXSIGSAPPDEXHKNRRSSXRWRNPTGL*RYQAXPLXXPSCALLF 668 K +RPGTVKRPR WR SIGSAP K + PL PSCALLF Sbjct: 98 KASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLF 157 Query: 669 XP 674 P Sbjct: 158 RP 159 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/78 (43%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPP--PXPPXPXPPPXXPPXPPPP-XP 900 P P P PP P P P PPPP P PP P PPP PP PPPP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Query: 901 XPXPXXXPXXXPPPPPXP 954 P P P PP PP P Sbjct: 195 YPPPPNAPNPPPPNPPYP 212 Score = 70.5 bits (165), Expect = 2e-12 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 YP P P PP P P P P PP P PP P P PP PPPP Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Query: 897 XXPXPPPXPXXXXPPPP 947 P PPP P PPPP Sbjct: 184 NPPYPPP-PNPPYPPPP 199 Score = 66.9 bits (156), Expect = 2e-11 Identities = 31/72 (43%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP----XPXPXPXX 918 P P PP P P P PP PP P P PPP PP PPPP P P P Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPN 227 Query: 919 XPXXXPPPPPXP 954 P PPPP P Sbjct: 228 APNPPYPPPPNP 239 Score = 66.5 bits (155), Expect = 3e-11 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 YP P P PP P PP P P PP P PP P P P PPPP Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Query: 897 XXPXPPPXPXXXXPPPP 947 PP P PPPP Sbjct: 154 PPYPPPLYPPPPNPPPP 170 Score = 66.1 bits (154), Expect = 4e-11 Identities = 35/82 (42%), Positives = 35/82 (42%), Gaps = 5/82 (6%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXP---P 887 YP P P PP P PP P P PP PP PP P PP PP P Sbjct: 148 YPPPPNPPYP-PPLYPPPPNPPPPNAPYPPPPYPP--PPNPPYPPPPNPPYPPPPNAPNP 204 Query: 888 PPPXXPXPPP--XPXXXXPPPP 947 PPP P PPP P PPPP Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPP 226 Score = 65.7 bits (153), Expect = 5e-11 Identities = 34/84 (40%), Positives = 34/84 (40%), Gaps = 7/84 (8%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXP--PXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXP-P 887 YP P P PP P P P P P P P PP P PP PP P P Sbjct: 108 YPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Query: 888 PPPXXPXP----PPXPXXXXPPPP 947 PPP P P PP P PPPP Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 64.9 bits (151), Expect = 9e-11 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPP---XPXPPPXXPPXPP- 888 P P P P PP P P P PP P PP P PPP PP PP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 889 --PPXPXPXPXXXPXXXPPPPPXP 954 PP P P P P PP PP P Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 64.5 bits (150), Expect = 1e-10 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP--PXX 902 P P PP P PP P P PP P PP P PP P PP P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 903 PXP-PPXPXXXXPPPP 947 P P PP P PPPP Sbjct: 150 PPPNPPYPPPLYPPPP 165 Score = 64.5 bits (150), Expect = 1e-10 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPX--PPXXPPXPPXXX-PXXPPXXPPXPP 887 YP P P PP P PP P P PP P PP P PP PP PP Sbjct: 99 YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Query: 888 ---PPPXXPXPP--PXPXXXXPPPP 947 PPP P PP P P PPPP Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/84 (38%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPP---XPXPPPXXPPXP 885 + P P P P PP P + P PPPP PP P PPP PP P Sbjct: 137 NAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP 196 Query: 886 PPP-XPXPXPXXXPXXXPPPPPXP 954 PPP P P P P PP P P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 4/81 (4%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPP--- 887 YP P P PP P P P P PP PP PP P PP P PP Sbjct: 116 YPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP--PPNPPYPPPLYPPPPNPPPPNAP 173 Query: 888 -PPPXXPXPPPXPXXXXPPPP 947 PPP P PP P P PP Sbjct: 174 YPPPPYPPPPNPPYPPPPNPP 194 Score = 63.7 bits (148), Expect = 2e-10 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 3/78 (3%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP---PPXP 900 P P P PP P S P PP PP PP PPP PP P PP P Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Query: 901 XPXPXXXPXXXPPPPPXP 954 P P P PP PP P Sbjct: 179 YPPPPNPPYPPPPNPPYP 196 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/72 (44%), Positives = 33/72 (45%), Gaps = 6/72 (8%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPP--PPXPP---XPXPPPXXPPXPPPP-XPXPXP 912 P P L PP P + P P PPP PP PP P PPP P PPPP P P P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Query: 913 XXXPXXXPPPPP 948 P PPPP Sbjct: 215 PNAPNPPYPPPP 226 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = +3 Query: 714 LYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP 893 LYP P P P P PP P P PP P PP P PP PP PPPP Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPP----PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Query: 894 PXXPXPPPXPXXXXPPPP 947 P PP P P PP Sbjct: 216 -NAPNPPYPPPPNAPNPP 232 Score = 62.9 bits (146), Expect = 4e-10 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP-X 897 P P P P P P + P P PP PP P P PP P PPPP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 898 PXPXPXXXPXXXPPPPPXP 954 P P P P PPPP P Sbjct: 155 PYPPPLYPPPPNPPPPNAP 173 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPP--PXPPXPXPPPXXPPXPPPP 894 P P P P PP P P P PP P P PP P PP P PPPP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNP-PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Query: 895 XPXPXPXXXPXXXPPPPPXP 954 P P P PPPP P Sbjct: 166 NPPPPNAPYPPPPYPPPPNP 185 Score = 59.3 bits (137), Expect = 5e-09 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 802 SXXPXXPXPPPPP-XPPXPXPPPXXPPXPPPP-XPXPXPXXXPXXXPPPPPXP 954 S P P PP PP PP P PPP PP PPPP P P P P PP P P Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 58.8 bits (136), Expect = 6e-09 Identities = 31/81 (38%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP---XPPP 891 P P P P PP P + P P P PP P P PPP PP PPP Sbjct: 115 PYPPPPNAPYPPPPNPPYPPP----PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Query: 892 PXPXPXPXXXPXXXPPPPPXP 954 P P P P PP PP P Sbjct: 171 NAPYPPPPYPPPPNPPYPPPP 191 Score = 58.0 bits (134), Expect = 1e-08 Identities = 25/53 (47%), Positives = 26/53 (49%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P + P P PPPP PP P PPP PP PP P P P PP PP P Sbjct: 85 PTNFSPNPPYPPPP-YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 7/73 (9%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPP------XPXPPPXXPPXPPPP-XPXPXPX 915 P P P P P PPPP PP P PPP PP PPPP P P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP 144 Query: 916 XXPXXXPPPPPXP 954 P PP PP P Sbjct: 145 NAPYPPPPNPPYP 157 Score = 56.4 bits (130), Expect = 3e-08 Identities = 28/70 (40%), Positives = 28/70 (40%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P P P P P PP P PP P PP PP PPPP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPY-PPPPNAPY-PP 142 Query: 918 XPXXXXPPPP 947 P PPPP Sbjct: 143 SPNAPYPPPP 152 Score = 56.4 bits (130), Expect = 3e-08 Identities = 31/83 (37%), Positives = 32/83 (38%), Gaps = 3/83 (3%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPP-PXPPXPXPP--PXXPPXP 885 + P P P P PP P P P PPP P PP P PP P PP Sbjct: 121 NAPYPPPPNPPYPPPPNAPYPPSPNA-PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY 179 Query: 886 PPPXPXPXPXXXPXXXPPPPPXP 954 PPP P P PPPP P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAP 202 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPP-PXXPPXPPPP-XPXPXPXXXPXXXPPPPPXP 954 P P PP PP P PP P PP PPPP P P P P PP PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 52.4 bits (120), Expect = 5e-07 Identities = 27/62 (43%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXP--PXPPXXXPXXPPXXPPXP---PPPPXXPXPPPXPXXXXPP 941 PP P P PP P P PP P PP PP PPPP P PPP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP-PNAPYPP 142 Query: 942 PP 947 P Sbjct: 143 SP 144 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 P PP PP P PP PP PP PPPP P P PP P PP Sbjct: 90 PNPPY---PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP---PYPPPPNAPYPP 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +3 Query: 717 YPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP 893 YP P P PP P P P P PP PP P P PP PPPP Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP------PNAP--NPPYPPPP 237 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/44 (68%), Positives = 31/44 (70%) Frame = -3 Query: 556 GAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 GAEPM+ CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 67.3 bits (157), Expect = 2e-11 Identities = 35/78 (44%), Positives = 35/78 (44%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G GGGG GG GGG G GG G GGG G G G GG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG-GGYGDGGGFGDGGGYADGDGGGGGG 852 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 853 GGGGGGGGGGGGGGGGGG 870 Score = 64.5 bits (150), Expect = 1e-10 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G GGG G GGG G GG GGGGG G G G GG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG-GGYGDGGGFGDGGG 841 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 842 YADGDGGGGGGGGGGGGG 859 Score = 63.3 bits (147), Expect = 3e-10 Identities = 32/66 (48%), Positives = 32/66 (48%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G GGGG GG GGG G G GGGGG G G G GG Sbjct: 777 GDGGGGGDGGGG--GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Query: 773 XXXXXG 756 G Sbjct: 835 GFGDGG 840 Score = 62.9 bits (146), Expect = 4e-10 Identities = 32/66 (48%), Positives = 32/66 (48%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXX 768 GGGGG G G G G GGGG GG GGG G GG GGG G G G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGG-GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 767 XXXGXG 750 G G Sbjct: 828 GGYGDG 833 Score = 62.1 bits (144), Expect = 6e-10 Identities = 33/75 (44%), Positives = 33/75 (44%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXX 764 GGG G GGG G GGGGG GG GG GG GG GG G G GG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG--GF 836 Query: 763 GXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 837 GDGGGYADGDGGGGG 851 Score = 61.3 bits (142), Expect = 1e-09 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G G GGGG GG GGG G GG G GG G G GG Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 858 GGGGGGGGGGGGGGGGGG 875 Score = 61.3 bits (142), Expect = 1e-09 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGG G G G GGGG GG GGG G GG GGGGG G G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 60.9 bits (141), Expect = 1e-09 Identities = 34/83 (40%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGG-----GXGXGGXGGGGGXGXXGXXXXGXX 789 G GGGG G G G G GGGG GG GG G G GG GGGGG G G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Query: 788 XXXGGXXXXXGXGXXXXXXGXXG 720 GG G G G Sbjct: 836 FGDGGGYADGDGGGGGGGGGGGG 858 Score = 59.7 bits (138), Expect = 3e-09 Identities = 31/69 (44%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXG-XGGXGGGGGXGXXGXXXXGXXXXXG 777 G GGGG G G G G GGGG GG GGG G GG G G G G G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 776 GXXXXXGXG 750 G G G Sbjct: 829 GYGDGGGFG 837 Score = 59.7 bits (138), Expect = 3e-09 Identities = 31/76 (40%), Positives = 31/76 (40%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGGG G G G G GGGGG GG GG G G GG G G GG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Query: 766 XGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 856 GGGGGGGGGGGGGGGG 871 Score = 59.3 bits (137), Expect = 5e-09 Identities = 31/70 (44%), Positives = 31/70 (44%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGGG G GGG G GGGGG GG GG G GG G GG G G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGG-GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 766 XGXXGGXXXG 737 G GG G Sbjct: 830 YGDGGGFGDG 839 Score = 59.3 bits (137), Expect = 5e-09 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G G GG GGG G GG G GGG G G G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGD 846 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 847 GGGGGGGGGGGGGGGGGG 864 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/60 (46%), Positives = 28/60 (46%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G G GG GG G GG GGGGG G G G GG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/68 (42%), Positives = 29/68 (42%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXGXXGGXX 743 G GGG G GGGGG GG GG G GG GG GG G GG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 742 XGXRGXXG 719 G G G Sbjct: 830 YGDGGGFG 837 Score = 57.2 bits (132), Expect = 2e-08 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXG---GXGGGGGXGXXGXXXXGXXXX 783 G GG G G G G G GGGG GG G G G G G GGGGG G G G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGD 832 Query: 782 XGGXXXXXGXGXXXXXXGXXG 720 GG G G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGG 853 Score = 56.0 bits (129), Expect = 4e-08 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 4/80 (5%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXX---GGGGGXGGXXGGXXGXXXGGXG-GXXGGXGXXXXGXXXXG 779 GGGG G GGG G GGGGG GG GG G G G G GG G G Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Query: 778 GXXXXGXXGGXXXGXRGXXG 719 G G GG G G G Sbjct: 854 GGGGGGGGGGGGGGGGGGGG 873 Score = 55.6 bits (128), Expect = 6e-08 Identities = 30/79 (37%), Positives = 30/79 (37%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG GG G G G GGGG GG GG GG G GGG G GG Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 773 XXXXXGXGXXXXXXGXXGV 717 G G G GV Sbjct: 859 GGGGGGGGGGGGGGGGGGV 877 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXGX 766 GGGG GG G GGGGG G GG G GG G G GG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 765 XGXXGGG 745 GGG Sbjct: 829 GYGDGGG 835 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = -2 Query: 899 GXGGGGXGGXXGG---GXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXG 729 G GGGG GG GG G G GG GGGGG G G G GG G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 728 XXG 720 G Sbjct: 829 GYG 831 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 66.9 bits (156), Expect = 2e-11 Identities = 48/113 (42%), Positives = 57/113 (50%), Gaps = 1/113 (0%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXLXQRR*YGYPQ-NQGITQERTCEQKASKGQEP* 516 +C G +PLPRSLTR ARSF CGER L + + +T E+ A+K Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPGRYLTGS---ERAAAK----- 111 Query: 517 KXXXXXXXXXXXXXLTSXTKIDAQVXGGETRXDYKDTRRXPXXLPRALSCSXL 675 LTS TK DAQ+ GGETR DYKDTRR P P SC+ L Sbjct: 112 ------PFFHRLRPLTSITKSDAQISGGETRQDYKDTRRFPLAAP---SCALL 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 66.5 bits (155), Expect = 3e-11 Identities = 29/63 (46%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPX---PPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 PP P P PPPPP PP P PP PP PPPP P P P PPPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Query: 946 PXP 954 P P Sbjct: 408 PPP 410 Score = 60.1 bits (139), Expect = 3e-09 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = +3 Query: 753 PXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXX 932 P P PP P P PP PP P P PP PPPP P PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPP--PPPPPTNGPPPPPPPTNGPPPPPPPTNG 403 Query: 933 XPPPP 947 PPPP Sbjct: 404 PPPPP 408 Score = 59.3 bits (137), Expect = 5e-09 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PPP PP P PP P PPPP P P P PPPPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXX---PXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P PP PP P PP PP P PP P PPPPP P PP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 941 PP 946 PP Sbjct: 406 PP 407 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPP---XPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPP 939 PP P P PPPPP PP P PP PP PPPP P P P PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 54.8 bits (126), Expect = 1e-07 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P P PP PP P PP PP PP PPPPP P P PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Query: 941 PP 946 PP Sbjct: 414 PP 415 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 3/70 (4%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXX---PPXPPPPPXXPX 908 P P P PP P P PP PP P PP PP PPPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 909 PPPXPXXXXP 938 PPP P P Sbjct: 406 PPPPPTNGPP 415 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPP 864 P P PPPPP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPP 89 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPP 888 P P PP P PP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPP 864 P P PPPPP P PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 864 PXXPPXPPPPPXXPXPPP 917 P PP PPPP P PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 64.5 bits (150), Expect = 1e-10 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFEXXD 416 SGG + CWPFAHMFFPALSPDSVDNRITAFE D Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 63.7 bits (148), Expect = 2e-10 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G GG GG G G G G GGGG GG GGG G GG GGGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 63.7 bits (148), Expect = 2e-10 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G GGGG G G G G GGGG GG GGG G GG GGGGG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 57.2 bits (132), Expect = 2e-08 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = -2 Query: 923 GXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G G G GGGG GG GGG G GG GGGGG G G G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGG 825 G GGGGG G G G G GGGG GG GGG G GG G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGG-GGGGGGGGGAGGAGAGAG 710 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GGG GG GGG G GG GGGGG G G G GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GGGG GG GGG G GG GGGGG G G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 52.8 bits (121), Expect = 4e-07 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 G GG G GGG G GGGGG GG GG G GG GG GG G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 52.0 bits (119), Expect = 7e-07 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -2 Query: 923 GXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G G GGGG GG GGG G GG GGGGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGGG G G G G GGGG GG GGG G G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGG--GGGAGGAGAGAGDDDG 714 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GGGGG G G G G GGGG GG G G G G G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG 809 GGGG G GGG G GGGGG GG GG G G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -1 Query: 942 GGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXG 778 GGG GG G G GGGGG G GG G GG GG G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXG 796 G GGGG GG G G GGGGG G GG G G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 63.3 bits (147), Expect = 3e-10 Identities = 28/47 (59%), Positives = 30/47 (63%) Frame = -3 Query: 565 SSGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 +SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 62.5 bits (145), Expect = 5e-10 Identities = 41/98 (41%), Positives = 48/98 (48%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXLXQRR*YGYPQNQGITQERTCEQKASKGQEP*K 519 +C G +PLPRSLTR ARSF CGER L + R + +G + Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGG------GDFLEDARKILNREVRGPRQSR 150 Query: 520 XXXXXXXXXXXXXLTSXTKIDAQVXGGETRXDYKDTRR 633 LTS TK DAQ+ GGETR DYKDTRR Sbjct: 151 FSIGSAP------LTSITKSDAQISGGETRQDYKDTRR 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -3 Query: 562 SGGAEPMEXRQXRGLFTVPGLCWPFAHMFFPALSPDSVDNRITAFE 425 SGG + CWPFAHMFFPALSPDSVDNRITAF+ Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 61.7 bits (143), Expect = 8e-10 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 499 CWPFAHMFFPALSPDSVDNRITAFE 425 CWPFAHMFFPALSPDSVDNRITAFE Sbjct: 113 CWPFAHMFFPALSPDSVDNRITAFE 137 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 61.3 bits (142), Expect = 1e-09 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGG G G G G G GGGG GG GGG G GG GGGGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 51.6 bits (118), Expect = 9e-07 Identities = 27/50 (54%), Positives = 27/50 (54%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 GG G G G G G GGGG GG GGG G GG GGGGG G G G Sbjct: 81 GGRGGGFGGGGGFGGG-GGGGFGGGGGGGFGGGG-GGGGGFGGGGGGGFG 128 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G G GG GG GGG G G GGGGG G G G GG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 899 GXGGGGXGGXXG-GGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG GG G GG G GG GGGGG G G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -2 Query: 887 GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 GG GG GGG G GG GGGG G G G GG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGG 826 G GGG GG G G GGGG G GG G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 60.5 bits (140), Expect = 2e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 499 CWPFAHMFFPALSPDSVDNRITAFE 425 CWPFAHMF+PALSPDSVDNRITAFE Sbjct: 21 CWPFAHMFYPALSPDSVDNRITAFE 45 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 60.5 bits (140), Expect = 2e-09 Identities = 29/53 (54%), Positives = 29/53 (54%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GGGGG G G G GGGG GG GGG G GG GGGGG G G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGG-GGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 59.7 bits (138), Expect = 3e-09 Identities = 27/51 (52%), Positives = 27/51 (52%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 GGGGG G G G G GGGG G GGG G GG GGG G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGG--GGXGGXXGGGXGXGGXGGGGGXGXXG 810 G GGGGG G G G G GG G GG GGG G GG GGGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G GGGGG G G G G G G GG GGG G G GGGGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 54.8 bits (126), Expect = 1e-07 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 G GGG G GGGGG GG GG G GG GG GG G G GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GGGG GG GGG G GG G GG G G G GG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G GGGG GG GGG G GG GG G G G G GG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -3 Query: 916 GGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXG 761 GGG G GGGGG GG GG GG G GG G G GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGG 793 GGGG GG G G GGGGG GG G GG GG G GG Sbjct: 64 GGGGGGGGGGGG---GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 878 GGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXGXXG 720 GG GGG G GG GGGGG G G GG G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 866 GGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXGXXGV 717 GGG G GG GGGGG G G GG G G G GV Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGV 113 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 59.3 bits (137), Expect = 5e-09 Identities = 29/60 (48%), Positives = 29/60 (48%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGG G G G G GG G GG GGG G GG G GGG G G G GG Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 57.6 bits (133), Expect = 1e-08 Identities = 32/82 (39%), Positives = 32/82 (39%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGG G G G GGG GG GGG GG GGGG G G G GG Sbjct: 153 GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Query: 773 XXXXXGXGXXXXXXGXXGVEXP 708 G G G V P Sbjct: 213 GYGGGGYGGGRSGGGGYEVSYP 234 Score = 56.8 bits (131), Expect = 2e-08 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXG-GGGGXGXXGXXXXGXXXXXG 777 G GGGG G G G GGGG GG GG G GG G GGGG G G G Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 776 GXXXXXGXGXXXXXXGXXG 720 G G G G G Sbjct: 207 GYGGGGGYGGGGYGGGRSG 225 Score = 56.0 bits (129), Expect = 4e-08 Identities = 33/79 (41%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG-GXGXXGXXXXGXXXXXG 777 G GGGGG G G G GGG GG G G G GG GGGG G G G G G Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGG-GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGG 193 Query: 776 GXXXXXGXGXXXXXXGXXG 720 G G G G G Sbjct: 194 GGYGGGGGGYGGSGYGGGG 212 Score = 52.8 bits (121), Expect = 4e-07 Identities = 33/82 (40%), Positives = 33/82 (40%), Gaps = 6/82 (7%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGG----GG--GXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXX 785 GGGG G GGG G GG GG G GG GG G G GG G G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 784 XGGXXXXGXXGGXXXGXRGXXG 719 GG G GG G G G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYG 204 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GGGG G GG G G GGG G G G G GG Sbjct: 131 GYGGGRGGGGGYRSGGGY-RGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 190 GYGGGGYGGGGGGYGGSG 207 Score = 49.6 bits (113), Expect = 4e-06 Identities = 33/83 (39%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Frame = -2 Query: 953 GXGG--GGGXXXGXXXGXGXGXGGG--GXGGXXGGGXGXGGXG-GGGGXGXXGXXXXGXX 789 G GG GGG G G G GGG G GG GGG G G G GGGG G G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 788 XXXGGXXXXXGXGXXXXXXGXXG 720 G G G G G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGG 205 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 58.8 bits (136), Expect = 6e-09 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 P P PPPPP PP P PPP PP PPPP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 56.8 bits (131), Expect = 2e-08 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 PPPPP PP P PPP PP PPPP P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPPPP PP P PPP PP PPPP P P PPPPP P Sbjct: 464 PPPPPPPP-PPPPPPPPPPPPPPPPFP---------PPPPPTP 496 Score = 54.8 bits (126), Expect = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P PPPPP PP P PPP PP P PP P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 52.0 bits (119), Expect = 7e-07 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP 894 P P P PPPPP PP P PPP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 5e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXP 905 P PP PP PP P PP PP PPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXP 923 PP PP PP P PP PP PPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPP---PPPFPPPPPPTP 496 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXP 876 P P P P PPPPP PP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPP 867 PP P P P PPPPP PP P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 35.5 bits (78), Expect = 0.064 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXP 901 P PP PP P PP PP P PP P PPPPP P Sbjct: 464 PPPPPPPPPPPP-------PPPPPPPP---PPPPFP-PPPPPTP 496 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPP 842 PP P PP P P PP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPP 849 P P PP P P P PPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXP 839 PP P PP P P PP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 762 PXXXXPPXXXXPXXXXPXPPXXPPXPPXXXP 854 P PP P P PP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 58.4 bits (135), Expect = 8e-09 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PPP PP P PP PP PPPP P P P PPP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/66 (39%), Positives = 27/66 (40%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXP 936 P + PP P P P PPPPP P P PPP PP PP P P P Sbjct: 198 PSQITQPPPPPPRPP---PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNM 254 Query: 937 PPPPXP 954 PP P Sbjct: 255 PPTLPP 260 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPP-PPXPPXPXPP-PXXPPXPPPPXPXPXPXXXPXXXPP 939 PP P S P P P P PP PP P PP P P P P P P P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = +3 Query: 684 DXVXFPXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXP 863 D + S P P PP P PP P P PP PP PP P Sbjct: 186 DQISIGTSHPTSPSQITQPPPPPPRPPPSPPPP----PPPPSPSPPRPPPPPPPSPPRPL 241 Query: 864 PXXPPXPPPPPXXPXPPPXP 923 P PPP P P P P Sbjct: 242 AAKLPEPPPIPNMPPTLPPP 261 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +3 Query: 753 PXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP--PXXPXPPPXPX 926 P P P P PP PP P P PP PP PP P P PPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPP-PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPN 253 Query: 927 XXXPPPP 947 PP Sbjct: 254 MPPTLPP 260 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPP-PPXP--XXXPXXPPXX 931 P P PP P PP PP P PP P PPP PP P P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPP--PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Query: 932 XPPP 943 PP Sbjct: 253 NMPP 256 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/89 (28%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 637 PXXLPRALSCSXLPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPX 816 P LP + + + S S P P P PP P P Sbjct: 173 PTRLPGNARVNAIDQISIGTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Query: 817 XPXPPPPPXP---PXPXPPPXXPPXPPPP 894 P PP P P P P P PP PPP Sbjct: 233 PPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 57.6 bits (133), Expect = 1e-08 Identities = 41/117 (35%), Positives = 43/117 (36%), Gaps = 8/117 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGG---XGGXXGGGXGXGG---XGGGGGXGXXGXXXXGX 792 G GGGG G G G G GGGG GG GGG G GG GGGGG G G G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG 1820 Query: 791 XXXXGGXXXXXGXGXXXXXXGXXGVEXPAXREXDXIRKGRXEQESA--RGXXQGXRL 627 G G G G G A + SA +G G RL Sbjct: 1821 GEGMGAAGGGMGAGGEGGGAGGGGGGYSAQKSSSSFSYTSSSSSSAARKGAYSGYRL 1877 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXGXXGGXX 743 G GGG G GGGGG G GG G GG GG G GG G GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 742 XGXRG 728 G G Sbjct: 1819 GGGEG 1823 Score = 52.0 bits (119), Expect = 7e-07 Identities = 30/68 (44%), Positives = 30/68 (44%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G GGG GG GGG GG GGG G G G GG Sbjct: 1757 GFGGGGG---GGGMGGGGGMAGGG-GGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGG 1812 Query: 773 XXXXXGXG 750 G G Sbjct: 1813 GGGGMGGG 1820 Score = 52.0 bits (119), Expect = 7e-07 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 5/80 (6%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGG----XXGGXXGXXXG-GXGGXXGGXGXXXXGXXXXG 779 GGG G GGG G GGGGG GG GG G G G GG GG G G G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 778 GXXXXGXXGGXXXGXRGXXG 719 G G G G G Sbjct: 1819 GGGEGMGAAGGGMGAGGEGG 1838 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 905 GXGXGGGGXG-GXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXG 729 G G GGGG G G GG G GG GGGG G G GG G G G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Query: 728 XXG 720 G Sbjct: 1817 MGG 1819 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/60 (48%), Positives = 29/60 (48%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GGGG GG GGG G GG GGGG G G G GG Sbjct: 187 GYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGG-GYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGG--GGXGGXXGGGX---GXGGXGGGGGXGXXGXXXXGXX 789 G GGGG G G G GG GG GG GGG G GG G GGG G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 788 XXXGG 774 GG Sbjct: 236 DYGGG 240 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/70 (35%), Positives = 26/70 (37%) Frame = -3 Query: 937 GXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXGX 758 G G G G GGGG GG GG G G GG GG G G GG G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGG--SGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Query: 757 XGGXXXGXRG 728 G +G Sbjct: 234 RHDYGGGSKG 243 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Frame = -1 Query: 954 GXXGGGG-XXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXG 778 G GGG GG G G GGG G GG G GG GG G GG G Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGG--GGYGGGHGGGGYGGGGRHDYG 238 Query: 777 GXGXXGXXGGG 745 G G GGG Sbjct: 239 G----GSKGGG 245 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG-GXXXXXGXGXXXXX 735 G G GGG G G G GG GGG G G G G G G G G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 734 XGXXG 720 G G Sbjct: 239 GGSKG 243 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 893 GGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXGXXG 720 G G GG GGG GG G GG G G G G G G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 820 PXPPPPPXP-PXPXPPPXXPPX--PPPPXPXPXPXXXPXXXPPPPPXP 954 P PPPPP P PPP PP PPPP P P P PPPPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPX--PPPPPXXPXPPPXPXXXXPPPP 947 P PP PP P PP PP PPPPP P PPP PPPP Sbjct: 290 PVPP--PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 PP P P P PPP PP P PPP PPPP P Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 780 PXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXP 923 P P P PP PP P PP PP PP P PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 PP P P PP P PP P PPPPP P PP PPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAP--PP---PPPP 337 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 8/36 (22%) Frame = +1 Query: 811 PXXPXPPPP---PXPPXPXPPP-----XXPPXPPPP 894 P P PPPP P PP P PPP PP PPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 761 PXXPXPPXXXX---PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXP 901 P P PP PP P PP PP P PP PPPPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP--PPGDGGAPPPPPPP 337 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 P P P P P P PPPPP P PP PP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP--PPPPP 337 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP 878 PP PP P P PP PP PP PP PP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 P P P PP P P PPP P P PP PPPP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPP---PPPPPGGAPPPPPPPPPPPP 325 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXP-XXXPPPPPX 951 PP P + P P PPP P P PP P PPPP P P P P P PPP Sbjct: 50 PPPPPPSPPAAAPAAP-PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPA 108 Query: 952 P 954 P Sbjct: 109 P 109 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P PP P P P P P P PP P PP P PPP P PPP Sbjct: 50 PPPPPPSPPAAA--PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Query: 918 XPXXXXP 938 P P Sbjct: 108 APPHFLP 114 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPX 909 P P P P P PPPP PP PPP P PPPP P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPA 102 Query: 910 PXXXPXXXPPPPP 948 P PP PP Sbjct: 103 P-----QPPPAPP 110 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP 894 S+P P P P P PPPPP P P PPP P PPP Sbjct: 48 SSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Query: 895 XP 900 P Sbjct: 108 AP 109 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPX--PPPP 893 P P P P P P P P P PP PP P PP P PP P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAP--PPPPPLPAPPPPPAQPAPQPPPAP 109 Query: 894 P 896 P Sbjct: 110 P 110 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP 878 P P P P P PP P P PP P P P PP P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXX--PPXXXXXPXSXXPXXPX--PPPPPXPPXPXPPPXXPPXPP 888 P P P P PP P + P P PPPPP P P PPP P P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP 879 + P P P P P P P PP P P P PP P Sbjct: 60 AAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 56.0 bits (129), Expect = 4e-08 Identities = 30/69 (43%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXG-GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GGG G G G G G G GGG GG G G GG GGG G G G G G Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Query: 776 GXXXXXGXG 750 G G G Sbjct: 194 GDGRGRGRG 202 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/73 (42%), Positives = 31/73 (42%), Gaps = 5/73 (6%) Frame = -2 Query: 953 GXGG--GGGXXXGXXXGXGXGXGGG-GXGGXXGGGXGXGGXGG--GGGXGXXGXXXXGXX 789 G GG G G G G G G GGG G GG GG G GG GG GGG G G Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 Query: 788 XXXGGXXXXXGXG 750 GG G G Sbjct: 188 GSRGGGGDGRGRG 200 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/81 (38%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGG---GXGGXXGGG-XGXGGXGGGGGXGXXGXXXXGXXXXXG 777 GG G G G G G GGG G G GGG G GG GG GG G G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Query: 776 GXXXXXGXGXXXXXXGXXGVE 714 G G G G G E Sbjct: 187 G--GSRGGGGDGRGRGRGGTE 205 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 55.6 bits (128), Expect = 6e-08 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 12/72 (16%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPP-------XPXPPPXXPPXP-----PPPXPXPXPXX 918 PP P PPPPP PP P PPP PP P PPP P P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 919 XPXXXPPPPPXP 954 PPPPP P Sbjct: 737 AGLPPPPPPPPP 748 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 7/65 (10%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPX---PPPXXPPXPP----PPXPXPXPXXXPXXX 933 PP P P PPPPP PP PPP P P PP P P P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Query: 934 PPPPP 948 PPPPP Sbjct: 755 PPPPP 759 Score = 48.8 bits (111), Expect = 6e-06 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +3 Query: 762 PXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXP-----PPPPXXPXPPPXPX 926 P PP P PP PP PP PP P P PPPP P PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPP--PPPPPGCA 751 Query: 927 XXXPPPP 947 PPPP Sbjct: 752 GLPPPPP 758 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXX---PPXPPXXXPXXPPXXPPXPPPPPXXP-XPPP 917 PP P P P PP PP PP P PP PPPPP PPP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP 756 Query: 918 XPXXXXPPPP 947 P P P Sbjct: 757 PPPIDVPMKP 766 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 7/76 (9%) Frame = +1 Query: 706 AGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPX---PXPPPXXP 876 + LS P P L PP P P PPP P P P PPP P Sbjct: 689 SSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCA-GLPPPPPSPQPGCAGLPPPPPPPP 747 Query: 877 P----XPPPPXPXPXP 912 P PPPP P P Sbjct: 748 PGCAGLPPPPPPIDVP 763 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 55.2 bits (127), Expect = 7e-08 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G GGG G G G G GG G GG GG G GG G GGG G G G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 773 XXXXXGXG 750 G G Sbjct: 96 GGNVGGGG 103 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G G G G G G G G G G GGGGG G GG Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Query: 773 XXXXXGXG 750 G G Sbjct: 98 NVGGGGSG 105 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/76 (36%), Positives = 28/76 (36%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGG G GGG G G GG G G G GG G GG G G G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 766 XGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 96 GGNVGGGGSGGVGGNG 111 Score = 48.4 bits (110), Expect = 8e-06 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G G GG G G G G GGGG G GG G G G GG G G G G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGXG-GGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXG 769 GGGG GG G G G G GG G G GG G G GG G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 768 XXGXXGGG 745 G GGG Sbjct: 95 AGGNVGGG 102 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXG-GGGGXGXXGXXXXGXXXXXGGX 771 GG G G G G G GGG G GG G GG GG G G G G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 770 XXXXGXG 750 G G Sbjct: 88 AGAAGAG 94 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/76 (38%), Positives = 29/76 (38%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGG G G G G G GGG G GG G GG GG G G GG Sbjct: 42 GGGNGGGAGNGVGAGGCGCGGGNDGGNGG-GGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Query: 766 XGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 101 GGGSGG--VGGNGGSG 114 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG G G G GG G GG GGG G GG G G G G G GG Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGG-GGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXG-GXGGXXXXXXXGXGGXXXXG 778 G GGG G G G G GG G G G G G GG G GG G Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Query: 777 GXGXXGXXGG 748 G G G GG Sbjct: 103 GSGGVGGNGG 112 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 1/80 (1%) Frame = -2 Query: 953 GXGGGG-GXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GGGG G G G G G G GG G GG G G GG G G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCG-CGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAA 91 Query: 776 GXXXXXGXGXXXXXXGXXGV 717 G G G G GV Sbjct: 92 G----AGAGGNVGGGGSGGV 107 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXX 732 G G G GGGG GG G G G G G GG G G G GG G G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGG---NGGGGAGNGGGGGGAGNG 85 Query: 731 GXXG 720 G G Sbjct: 86 GAAG 89 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 4/79 (5%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXG----GXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GG G GG G G GGG G G G G GG GG G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 775 XXXXGXXGGXXXGXRGXXG 719 G G G G G Sbjct: 88 AGAAGAGAGGNVGGGGSGG 106 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 54.8 bits (126), Expect = 1e-07 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 2/90 (2%) Frame = +1 Query: 691 SXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPX 870 S S G P P P P PP P PPPPP P PPP Sbjct: 911 SASPPGGSVPPPPPPPGGNAPLPPP---PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPG 967 Query: 871 X--PPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP PPPP P P PPPPP P Sbjct: 968 GGAPPLPPPPGGSAPPPPPP---PPPPPPP 994 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXP----PXPXPPP--XXPPXPPPPXPXPXPXXXPXXXPP 939 P P + P PPPPP P P P PPP P PPPP P P Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSA 963 Query: 940 PPP 948 PPP Sbjct: 964 PPP 966 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXX--PXPPPXP 923 P P P P P PP P P P P PPPP P PPP P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Query: 924 XXXXPPP 944 PPP Sbjct: 960 GGSAPPP 966 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXX--PPXPPXXXPXXPPXXPPXPPP- 890 P P PP PP P PP P PP PP PP PP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP--PPPPPGG 961 Query: 891 ---PPXXPXP--PPXPXXXXPPPP 947 PP P PP P PPPP Sbjct: 962 SAPPPGGGAPPLPPPPGGSAPPPP 985 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 802 SXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 S P P P PPP PP P P P P PPPP Sbjct: 901 SQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 832 PPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 P P P PP P P P P PPPP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPP 937 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 GGGGG G G G GGGG GG GGG G GG GGGGG G Sbjct: 132 GGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G G GGGG GG GGG G GG GGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G G GGGG GG GGG G GG GGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G G GGGG GG GGG G GG GGGGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G G GGGG GG GGG G GG GGGGG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GGGGG G G G G GGGG GG GGG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXG 837 G GGGGG G G G G GGGG GG GGG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGGDG 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 890 GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXG 756 GGG GG GGG G GG GGGGG G G G G G Sbjct: 132 GGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 P P PPPPP P P PPP PP PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 P PPPPP PP P P PP PPPP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 50.4 bits (115), Expect = 2e-06 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 PPPPP PP P P PP PPPP P P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 47.6 bits (108), Expect = 1e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 861 PPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 PP PP PPPPP P PPP P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 835 PPXPPXPXPPPXXPPXPPPPXPXPXPXXXP 924 PP PP P PPP P PPPP P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXP 905 P PP PP PP P PP PP PPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPP--PPPPPPPPPTP 1186 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 859 PPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPP PP PPP P P P P PPPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPP---PPPPPPPPPTP 1186 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 874 PPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP PPPP P P P PPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 864 PXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP PPPPP PP P PPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXPPXPXPPP 867 P P P P PPPPP PP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.084 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXP 876 P P P P PP PP P PPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXP 861 PP P P PPPPP PP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP 884 P P PP P P P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPP 864 PP P S P PPPPP PP P P Sbjct: 1161 PPPPPPPPSSPSP----PPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 762 PXXXXPPXXXXPXXXXPXPPXXPPXPP 842 P PP P P PP PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXP 850 P PP PP P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 52.8 bits (121), Expect = 4e-07 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P PPPPP PP P PPP P PPPP P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 P PPPPP PP P PPP P PPP P P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 50.4 bits (115), Expect = 2e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPPPP PP P PPP PP P P P P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 50.0 bits (114), Expect = 3e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 P P PPPPP PP P P P PP PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PP P PPP PP PPPP P P P P PPPP P Sbjct: 675 PIPIQTMVPPPPPPPP--PPPPPPPPPPPQPSTPP---PPPPSTP 714 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXP 924 P PPPP PP P PPP PP P P P P P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P PPPPP PP P PP P PPPP P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 766 LXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPP 891 L P P P P PPPPP PP P PP PP PP Sbjct: 674 LPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +3 Query: 831 PXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P P PP PP PPPPP PPP P PPPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPP----PPPQPSTPPPPPP 711 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P P PP P PP PP PPP P P PPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPP--PXPPXPXPPP---XXPPXPPPPXPXPXPX 915 P P PP P P P PP P P PP P PP P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSA 734 Query: 916 XXPXXXPPPP 945 P PPPP Sbjct: 735 GNPQQQPPPP 744 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P PP PP P PP PP PP P P PPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPP-PPPPPQPSTPPPPPP 711 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 835 PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P PPPP P P P P PPPPP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPP---PPPPPPPPPQP 703 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPP--PPPXP 954 P P P P P PPPP P P P P P PPP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P PP P PP P P PP PP P P P PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGG-XGGXXGGXGXXXXGXXXXGGXXXX 764 GG G GG GG G G G GG GG GG GG Sbjct: 539 GGNNNGGNNGG-SNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNG 597 Query: 763 GXXGGXXXGXRGXXG*RXQLXGKXTXSXRAGXN 665 G GG G G G G N Sbjct: 598 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 630 Score = 35.1 bits (77), Expect = 0.084 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G GG G GG GG GG G G G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 614 Score = 35.1 bits (77), Expect = 0.084 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G GG G GG GG GG G G G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 640 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/78 (28%), Positives = 22/78 (28%), Gaps = 6/78 (7%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPX 908 P P P PP P P PP PP P P P P P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPA 726 Query: 909 PPP------XPXXXXPPP 944 P P PPP Sbjct: 727 GSPSGTSAGNPQQQPPPP 744 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGX-GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G G GG GG GG G GG G G G G Sbjct: 592 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSG 651 Query: 776 GXXXXXGXG 750 G G Sbjct: 652 EVTIQPGGG 660 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGG-XGGXXGGXGXXXXGXXXXGGXX 770 GG G G GG G G G GG GG GG GG Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNN 621 Query: 769 XXGXXGGXXXGXRG 728 G GG G G Sbjct: 622 NGGNTGGNNGGNTG 635 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGG--XGGXXGGXGXXXXGXXXXGGX 773 GG G G GG GG GG G GG GG GG GG Sbjct: 575 GGNNGGNTGGNNNGGNTGGNNN-GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGN 633 Query: 772 XXXGXXGGXXXGXRGXXG 719 GG G G Sbjct: 634 TGGNNNGGNSGGSNSHSG 651 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGG 775 G GG G G G GG G GG G G GG G GG Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG--GNTGGNNNGGNTGGNNGGNTGG 636 Query: 774 XGXXGXXGG 748 G GG Sbjct: 637 NNNGGNSGG 645 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G GG GG GG G GG G G G Sbjct: 584 GNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P PP P PP P P P P P PPPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNP--QQQPPPPGQ 746 Query: 900 XPXPPPXPXXXXP 938 P P P Sbjct: 747 LPGQQPGQAGGRP 759 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G G GG G G GG GG G G G Sbjct: 557 GSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 615 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G G GG G G GG GG G G G Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 641 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G GG GG GG GG GG Sbjct: 451 GGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGG 492 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G GG G GG G GG G G G Sbjct: 510 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNG 562 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXX-GGXXGXXXGGX-GGXXGGXGXXXXGXXXXGGXXX 767 GG GG G GG GG GG G GG GG G G Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 630 Query: 766 XGXXGGXXXG 737 G GG G Sbjct: 631 GGNTGGNNNG 640 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG GG GG GG Sbjct: 457 GNNNGGNNNVGNNNG-GNNNGGNNNGGNNNGGNNNGGNNNGG 497 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG GG GG GG Sbjct: 491 GGNNNGGNNNGENNG-GNNNGGNNNGGNNNGGNNNGGNNNGG 531 Score = 31.9 bits (69), Expect = 0.79 Identities = 22/102 (21%), Positives = 23/102 (22%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXG 761 GG GG G GG G GG G GG G Sbjct: 530 GGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 589 Query: 760 XXGGXXXGXRGXXG*RXQLXGKXTXSXRAGXNRRAHEGXXRG 635 GG G G G N + G G Sbjct: 590 NTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG G G G GG G G GG GG G G G Sbjct: 566 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGN 625 Query: 773 XXXXXG 756 G Sbjct: 626 TGGNNG 631 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/75 (24%), Positives = 18/75 (24%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXX 764 GG GG G G G G GG G G GG Sbjct: 471 GGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNG 530 Query: 763 GXXGGXXXGXRGXXG 719 G G G G Sbjct: 531 GNNNGENNGGNNNGG 545 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG G G G GG G GG G GG G G G G Sbjct: 525 GGNNNGGNNNGENNG-GNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTG 583 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G Sbjct: 584 GNNNGGNTGGNNNGGNTG 601 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G G G GG GG GG GG G G GG Sbjct: 497 GNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGG 554 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/79 (26%), Positives = 21/79 (26%), Gaps = 1/79 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGX-GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G GG GG GG G GG G G G Sbjct: 549 GSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNT 608 Query: 776 GXXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 609 GGNNNGGNTGGNNNGGNTG 627 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXG 761 GG G GG G GG G GG G G GG G Sbjct: 428 GGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGG 487 Query: 760 XXGG 749 G Sbjct: 488 NNNG 491 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G GG GG G G GG G G G Sbjct: 505 GGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGG 563 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGG--GGXGXXGXXXXG 795 G GG G G GG G GG G GG GG G G Sbjct: 413 GNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVG 467 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GG G G GG GG G G GG G Sbjct: 471 GGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNG 515 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GG G G GG G GG G GG G Sbjct: 476 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNG 520 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGX---GXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG GG GG GG Sbjct: 482 GNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGG 526 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = -1 Query: 939 GGXXXGGXXGXXXGXG--GGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXGX 766 GG GG G G GG G GG G GG GG G Sbjct: 548 GGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGN 607 Query: 765 XGXXGGG 745 G G Sbjct: 608 TGGNNNG 614 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = -1 Query: 939 GGXXXGGXXGXXXGX--GGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXGX 766 GG GG G G GG G G G GG G G G Sbjct: 566 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGN 625 Query: 765 XGXXGGG 745 G GG Sbjct: 626 TGGNNGG 632 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGG---GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G GG G GG GG G GG G G G Sbjct: 580 GNTGGNNNGGNTG-GNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGG 632 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG GG GG Sbjct: 446 GGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGG 487 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G G GG G GG G G G Sbjct: 515 GGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGG 567 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGX---GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G GG GG GG G G G G G Sbjct: 516 GNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNG 571 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 2/69 (2%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGXG--GGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGX 772 G G GG G G GG G GG G GG GG Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Query: 771 GXXGXXGGG 745 G G G Sbjct: 632 GNTGGNNNG 640 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG GG G GG Sbjct: 434 GNNGGNNNGGNTG-GDNNGGNNYGGNNNGGNNNVGNNNGG 472 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/60 (25%), Positives = 15/60 (25%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG G G G G GG G GG G GG Sbjct: 447 GDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 506 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/95 (25%), Positives = 24/95 (25%), Gaps = 3/95 (3%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGX--GGX-XGGXGXXXXGXXXXGGXX 770 GG G G GG G G G G GG GG GG Sbjct: 510 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNN 569 Query: 769 XXGXXGGXXXGXRGXXG*RXQLXGKXTXSXRAGXN 665 G GG G G G G N Sbjct: 570 NGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 604 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/75 (25%), Positives = 19/75 (25%), Gaps = 1/75 (1%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXG-GXXGGXGXXXXGXXXXGGXXXX 764 GG G G GG G G G GG G G G G Sbjct: 418 GGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGG 477 Query: 763 GXXGGXXXGXRGXXG 719 GG G G Sbjct: 478 NNNGGNNNGGNNNGG 492 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G G GG GG G GG GG Sbjct: 437 GGNNNGGNTGGDNNG-GNNYGGNNNGGNNNVGNNNGGNNNGG 477 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GG G G GG G GG GG GG Sbjct: 443 GNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGG 482 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/79 (26%), Positives = 21/79 (26%), Gaps = 4/79 (5%) Frame = -3 Query: 943 GGGXXXXGXGGGXGX-XGGGGGXGGXXGG---XXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GG GG G GG GG G G GG G G GG Sbjct: 433 GGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGG 492 Query: 775 XXXXGXXGGXXXGXRGXXG 719 G G G G Sbjct: 493 NNNGGNNNGENNGGNNNGG 511 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/60 (25%), Positives = 15/60 (25%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GG G G G G GG G GG G GG Sbjct: 481 GGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 540 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 496 WPFAHMFFPALSPDSVDNRITAFE 425 WPFAHMFF ALSPD VDNRITAFE Sbjct: 38 WPFAHMFFRALSPDCVDNRITAFE 61 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GGG G GGG GG GG G G G GG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 308 GATGVGGGATGGGGGATG 325 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GGG G GGG GG GG G G G GG Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 315 GATGGGGGATGGGVGATG 332 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GGG G GGG GG GG G G G GG Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 322 GATGGGVGATGGGGGATG 339 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGG-GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGX 771 GGGGG G G G G GG GG GGG G G GGG G G G GG Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGG 335 Query: 770 XXXXGXG 750 G G Sbjct: 336 GATGGGG 342 Score = 52.0 bits (119), Expect = 7e-07 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 3/79 (3%) Frame = -3 Query: 946 GGGGXXXXGXG---GGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GGGG G G GG G GGGGG G GG G GG G GG G G GG Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATG---GGGGATGGGVGATGGGGGATGG 340 Query: 775 XXXXGXXGGXXXGXRGXXG 719 GG G G G Sbjct: 341 GGGVTGGGGGATGGGGGPG 359 Score = 52.0 bits (119), Expect = 7e-07 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGG-XGGXXGGXXGXXXGGXGGXXGGXG-XXXXGXXXXGGX 773 GGGG G GG G GG G GG GG G GG G GG G G GG Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 350 GATGGGGGPGSGGCGEDG 367 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGG--GGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGX 773 GGGG G GG G GG GGG G GG GG GG G GG Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGV 328 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 329 GATGGGGGATGGGGGVTG 346 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXX 768 GGGG G G G GG GG GGG G G GGG G G G GG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 767 XXXGXG 750 G G Sbjct: 302 ATGGGG 307 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXX 768 GGG G G G G GGG G GGG GG GG G G G GG Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 767 XXXGXGXXXXXXGXXG 720 G G G G Sbjct: 303 TGGGGGATGVGGGATG 318 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGG--GGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXX 781 G GGGG GG G G GG GGG G GG GG G GG Sbjct: 245 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Query: 780 GGXGXXGXXGG 748 GG G G GG Sbjct: 305 GGGGATGVGGG 315 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGG--XXXXXXXGXGGXXXX 781 G GGGG GG G G GG G G G G GG GG G GG Sbjct: 280 GATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATG 339 Query: 780 GGXGXXGXXGG 748 GG G G GG Sbjct: 340 GGGGVTGGGGG 350 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -2 Query: 938 GGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXX 759 G G G G G GGG G GGG GG GG G G G GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 758 GXGXXXXXXGXXGV 717 G G G GV Sbjct: 299 GGGATGGGGGATGV 312 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 3/79 (3%) Frame = -3 Query: 946 GGGGXXXXGXG--GGXGXX-GGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GGGG G G GG G GGGGG G GG G G GG G G GG Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGA--TGGG 334 Query: 775 XXXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 335 GGATGGGGGVTGGGGGATG 353 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G G G G GGG GG G G G G GG Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Query: 773 XXXXXGXGXXXXXXGXXGVE 714 G G G G E Sbjct: 350 GATGGGGGPGSGGCGEDGTE 369 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXGXG--GGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGX 773 GGGG G G GG G GGG GG GG G GG G GG G G GG Sbjct: 263 GGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGGGGGATGGGGGATGVGGGATGG- 319 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G Sbjct: 320 -GGGATGGGVGATGGGGG 336 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 4/73 (5%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGG----GGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXX 787 G GGGG GG G G GG GGG GG G G GG G GG Sbjct: 287 GATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGG--GGGATGGGGGV 344 Query: 786 XXGGXGXXGXXGG 748 GG G G GG Sbjct: 345 TGGGGGATGGGGG 357 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 942 GGGXXXGGXXGXXXGXGG--GGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXG 769 GGG GG G G GG GGG G GG GG G GG GG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 768 XXGXXGG 748 G GG Sbjct: 302 ATGGGGG 308 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG--XXXXGXXXXGGXXXXGXXGG 749 G GG G GGGGG G GG G G GG GG G G GG G GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATG----GGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Query: 748 XXXGXRGXXG 719 G G G Sbjct: 295 ATGGGGGATG 304 Score = 35.1 bits (77), Expect = 0.084 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -1 Query: 942 GGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGXGXX 763 GG G GG G G G G GG GG GG G G Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Query: 762 GXXGGG 745 GGG Sbjct: 288 ATGGGG 293 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPX 909 P P P PP P P P P P P P PP P PPP P P Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPI 1094 Query: 910 PXXXPXXXPPPPPXP 954 P PPP P Sbjct: 1095 PTNPAHPTEPPPRQP 1109 Score = 48.8 bits (111), Expect = 6e-06 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 3/76 (3%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPX 909 P P P PP P S P P P P P PP P PPP P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 910 PXXXP---XXXPPPPP 948 P P P PPP Sbjct: 1073 PRQPPPPSTSQPVPPP 1088 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXP-PXPP-PP 894 P P P PP P S P PPPP P PPP P P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 895 XPXPXPXXXPXXXPPPPP 948 P P P P P P Sbjct: 1100 HPTEPPPRQPKPTPAPRP 1117 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 2/74 (2%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPX-XPPXPPXXXPXXPPXXP-PXPPPPPXX 902 PR P P P PP P P PP PP P P PP P P P P Sbjct: 1044 PRKPSPPPSAVPIP--PPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHP 1101 Query: 903 PXPPPXPXXXXPPP 944 PPP P P Sbjct: 1102 TEPPPRQPKPTPAP 1115 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 4/77 (5%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPX----PPPXXPPXPPPPX 897 P P P PP P + P P P P P P PPP P P P Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPR 1116 Query: 898 PXPXPXXXPXXXPPPPP 948 P P PPPP Sbjct: 1117 PRSWVESQPELHRPPPP 1133 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/74 (36%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP---XPPPPPXXPX 908 P P P PP P P P PP P P PP PP P PPP P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPP-PRKPSPPPSEPAPPPRQPP--PPSTSQPVPPPRQPD 1092 Query: 909 P-PPXPXXXXPPPP 947 P P P PPP Sbjct: 1093 PIPTNPAHPTEPPP 1106 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP-PXXPXPPPXPX 926 PP P P P PP P PP P PP PPPP P PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR---QPPPPSTSQPVPPPRQP 1091 Query: 927 XXXPPPP 947 P P Sbjct: 1092 DPIPTNP 1098 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 9/78 (11%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXP-----PXXXPXXPPXXPPXPPP---- 890 P PP P PP P P PP P P PP P PPP Sbjct: 991 PHPSPPMQPAK--PPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPS 1048 Query: 891 PPXXPXPPPXPXXXXPPP 944 PP P P P PPP Sbjct: 1049 PPPSAVPIPPPRKPSPPP 1066 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 5/77 (6%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXX---PXXXXPXPPXXPPXPP--XXXPXXPPXXPPXPPPP 893 P P P PP P P P P PP P P PP PPP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Query: 894 PXXPXPPPXPXXXXPPP 944 P P P P P P Sbjct: 1079 PSTSQPVPPPRQPDPIP 1095 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P P P PP P P P P P PP P P P Sbjct: 1059 PRKPSPPPSEPAPPPRQPPPPSTSQPVPP-PRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Query: 900 XPXPPPXPXXXXPPPP 947 P PPPP Sbjct: 1118 RSWVESQPELHRPPPP 1133 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXP-PPPPXXPXPP---PXPXXXXPPPP 947 P PP PP P PP P PPP P PP P P P PP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKP---SPPPSAVPIPPPRKPSPPPSEPAPP 1072 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP--XPPPP 893 P P P P P P P PP P P P P PPP Sbjct: 1073 PRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPP 1132 Query: 894 PXXPXP 911 P P P Sbjct: 1133 PIKPKP 1138 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 1/67 (1%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXP-XPXXXPX 927 P P P S P PP P P P P P P P P Sbjct: 993 PSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPS 1052 Query: 928 XXPPPPP 948 P PPP Sbjct: 1053 AVPIPPP 1059 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 3/71 (4%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXP--PXXXXXPXSXXPXXPXPPPP-PXPPXPXPPPXXPPXPPP 891 P P P P P P P P P PPP P P P P P Sbjct: 1066 PSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQP 1125 Query: 892 PXPXPXPXXXP 924 P P P Sbjct: 1126 ELHRPPPPIKP 1136 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 52.4 bits (120), Expect = 5e-07 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 12/84 (14%) Frame = +3 Query: 732 RXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXX------------PXXPPXXP 875 R P PP P PP PP PP P P P P Sbjct: 136 RAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Query: 876 PXPPPPPXXPXPPPXPXXXXPPPP 947 P PPPPP P PPP PPPP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPPP 219 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P + PPPP P PPP P P P P P P PPPP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXP---PXPPPPXPXPXPXXXPXXXPPPPP 948 P + P PPPP P P P P PPPP P P P PPPPP Sbjct: 156 PIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P + P P P P PP PP PPPP P P P PPPP Sbjct: 169 PIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP-XPXPXPXXXPXXX 933 P + P S P P PP P P P P PP P P P P P Sbjct: 90 PAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATG 149 Query: 934 PPPPPXP 954 PPPP P Sbjct: 150 GPPPPPP 156 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/79 (32%), Positives = 26/79 (32%) Frame = +1 Query: 718 TPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPX 897 TP P P PP P S P PPPP P PPP P P Sbjct: 109 TPPPPPRAPETPSQAPSPPPP-----PTSPATRAPPPPPPIAPATGGPPPPPPIAPATGG 163 Query: 898 PXPXPXXXPXXXPPPPPXP 954 P P P P P P P Sbjct: 164 PPPPPPIAPAATVPAPAVP 182 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 762 PXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPP 941 P PP P PP P P P PP P PP P PP P PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPP--PPPPIAPATGGPP 165 Query: 942 PP 947 PP Sbjct: 166 PP 167 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 7/73 (9%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPX--PPPPXPX-----PXPX 915 P PP P + P P P P P PPP P P P P P P Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPS 192 Query: 916 XXPXXXPPPPPXP 954 P PPPPP P Sbjct: 193 GGPPPPPPPPPPP 205 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 14/90 (15%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPX--PPXXXPXXPPXXPPXPPPP 893 P PR P P P PP P PP P PP P P P PPPP Sbjct: 111 PPPPRAPET-PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 894 ------------PXXPXPPPXPXXXXPPPP 947 P PP P PPPP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPP 199 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/76 (31%), Positives = 25/76 (32%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP 894 +T P P PP P P P PP PPP PP PPPP Sbjct: 147 ATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Query: 895 XPXPXPXXXPXXXPPP 942 P P PPP Sbjct: 207 ---PPPILELAAPPPP 219 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 8/84 (9%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXP----PXPP 888 P P P PP P + P P P P P PPP P P PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 889 PP----XPXPXPXXXPXXXPPPPP 948 PP P P PPPP Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPP 191 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 8/68 (11%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPP----PXPPXPX----PPPXXPPXPPPPXPXPXPXXXPXX 930 PP P + P P P P P P P PPP PPPP P P P P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPIL 211 Query: 931 XPPPPPXP 954 PP P Sbjct: 212 ELAAPPPP 219 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP---X 920 PP P P P PP P P PP P P PPP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIA 145 Query: 921 PXXXXPPPP 947 P PPPP Sbjct: 146 PATGGPPPP 154 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P P P PP P P P P PPP P Sbjct: 87 PLVPAGVEAPTPTPMVAQSVAPTPPPP-PRAPETPSQAPSPPPPP 130 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 832 PPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P PP P P P P PPPPP Sbjct: 76 PTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPP 114 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 7/48 (14%) Frame = +1 Query: 832 PPPXPP---XPXPPP----XXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P P P P P PPPP P PPPP P Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSP 133 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/84 (40%), Positives = 34/84 (40%), Gaps = 8/84 (9%) Frame = -3 Query: 946 GGGGXXXXGXG---GGXGXXGGGGGXGGXXGGXXG---XXXGGXGGXXGGXG--XXXXGX 791 GGGG G G GG G GGGGG G GG G GG GG GG G G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Query: 790 XXXGGXXXXGXXGGXXXGXRGXXG 719 GG G GG G G G Sbjct: 145 ATGGGGGATGGGGGATGGGGGATG 168 Score = 50.8 bits (116), Expect = 2e-06 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXG--XGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGX 773 GGGG G GGG G GGGGG G GG G G G GG G GG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATG--DGGGATGGGGGATGGGG 108 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 109 GATGGHGGATGGGVGATG 126 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXX 768 GG GG G G G GGG G GGG GG GG G G G GG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA 103 Query: 767 XXXGXGXXXXXXGXXG 720 G G G G Sbjct: 104 TGGGGGATGGHGGATG 119 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGG--XXXXXXXGXGGXXXX 781 G GGGG GG G G GG G G G G GG GG G GG Sbjct: 95 GATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATG 154 Query: 780 GGXGXXGXXGG 748 GG G G GG Sbjct: 155 GGGGATGGGGG 165 Score = 49.2 bits (112), Expect = 5e-06 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 4/80 (5%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGG--GGGXGGXXGGXXGXXXGGXGGXXGGXG--XXXXGXXXXG 779 GGGG G GG G GG GGG G G G GG GG GG G G G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGAT--GDGGGATGGGGGATGGGGGATGGHGGATGG 120 Query: 778 GXXXXGXXGGXXXGXRGXXG 719 G G GG G G G Sbjct: 121 GVGATGGHGGATGGHGGATG 140 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXX 768 GGGGG G G G G G GG GG G GGGG G G G GG Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG 129 Query: 767 XXXG 756 G Sbjct: 130 GATG 133 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 3/72 (4%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXG---GGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXX 784 G GGGG GG G G G GGGG GG G GG G G GG Sbjct: 60 GATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG-AT 118 Query: 783 XGGXGXXGXXGG 748 GG G G GG Sbjct: 119 GGGVGATGGHGG 130 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGG-GGXGGXXGGXXGXXXGGXGGXXG-GXGXXXXGXXXXGGX 773 GGGG GG G GG GG GG GG G GG G G G G G Sbjct: 84 GGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHG 143 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 144 GATGGGGGATGGGGGATG 161 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 4/74 (5%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGG--GGGXG--GXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXG 779 GGGG G GG G GG GGG G G GG G G GG G G G G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATG--GGGGATGG 155 Query: 778 GXXXXGXXGGXXXG 737 G G GG G Sbjct: 156 GGGATGGGGGATGG 169 Score = 46.0 bits (104), Expect = 5e-05 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 4/80 (5%) Frame = -3 Query: 946 GGG--GXXXXGXGGGXGXXGGG--GGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXG 779 GGG G G GGG GGG GG GG GG G G G GG G G G Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Query: 778 GXXXXGXXGGXXXGXRGXXG 719 G G GG G G Sbjct: 113 G--HGGATGGGVGATGGHGG 130 Score = 45.6 bits (103), Expect = 6e-05 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGG-XGGGGG-XGXXGXXXXGXXXXX 780 G GG G G G G GGG GG G G GG GGGGG G G G Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGAT 104 Query: 779 GGXXXXXG 756 GG G Sbjct: 105 GGGGGATG 112 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 3/78 (3%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGG--GGXGGXXGGXXGXXXGGXGGXXGGXG-XXXXGXXXXGGX 773 GG G GGG GGG GG GG GG G G G GG G G G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHG 136 Query: 772 XXXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 137 GATGGHGGATGGGGGATG 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGG--GGGXGXXG 810 G GG G G G G GGG G GGG GG GG GGG G G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATG 126 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 5/73 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGG-----GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXX 789 G GG G G G G GG GG GG GGG G G G GG G G G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATG-GHGGATGGHGGATGGHG 143 Query: 788 XXXGGXXXXXGXG 750 GG G G Sbjct: 144 GATGGGGGATGGG 156 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGG-GGXGGXXGG-GXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 GGGGG G G G G GG GG GG G GG GG G G G GG Sbjct: 105 GGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 7/77 (9%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGG--GGGXGXXXG-----GXXXGXXGGXGGXXXXXXXGXG 796 G GGGG G G G GG GGG G G G G GG GG G Sbjct: 81 GATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATG 140 Query: 795 GXXXXGGXGXXGXXGGG 745 G G G GGG Sbjct: 141 GHGGATGGGGGATGGGG 157 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGG--GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXX 780 G GG G G G G GG GG GG GG G G GGGG G G G Sbjct: 109 GATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATG-GGGGATGGGGGATGGGGGAT 167 Query: 779 GG 774 GG Sbjct: 168 GG 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGX--GGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGGX 772 GGGG GG G G GGGG G GG G G G G GG GG Sbjct: 52 GGGGATGGGATGGGGGATGGGGGATG-GHGGATGGGGGATG--DGGGATGGGGGATGGGG 108 Query: 771 GXXGXXGG 748 G G GG Sbjct: 109 GATGGHGG 116 Score = 37.1 bits (82), Expect = 0.021 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXG--GGGG--XGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GG GG GGG G G G GGGG G G G GG G G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXG-GGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GG G GG G GG GGG G G G GG G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG 86 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 51.2 bits (117), Expect = 1e-06 Identities = 28/57 (49%), Positives = 28/57 (49%) Frame = -3 Query: 499 CWPFAHMFFPALSPDSVDNRITAFEXXDXXXXXXXXXXXXXXXXXXXXRPIRKPPLP 329 CWPF HMF PALSPDSVD ITAFE D R IRK LP Sbjct: 21 CWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRESVSEEAEERSIRKQTLP 77 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 50.8 bits (116), Expect = 2e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 GGGG G G G GGGG GG GGG GG GGG G G Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGG---GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXX 783 G G GG G G G GG GG GG GGG GG GGGG G G G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRD 143 Query: 782 XGGXXXXXG 756 GG G Sbjct: 144 YGGGSKGGG 152 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G GG GG GG G GG GG G G G GG G G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 35.5 bits (78), Expect = 0.064 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG-XXXXGXXXXGGXX 770 G GG G G G GG GG GG G GG GG GG G G GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSS-RGGYGGGRGG---GGYGGGRGGGGYGGGRGGGYGGGRR 142 Query: 769 XXGXXGGXXXG 737 G GG G Sbjct: 143 DYG--GGSKGG 151 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP---XP 885 S P P P P P P P P PPP P PP P P Sbjct: 204 SAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEP 263 Query: 886 PPPXPXPXPXXXPXXXPPPPP 948 PPP P P PPPPP Sbjct: 264 PPPKNAPPPPKRGSSNPPPPP 284 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXP----PXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPP 942 PP P P PPPPP P P PPP PPP P P PPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-PPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Query: 943 PP 948 PP Sbjct: 360 PP 361 Score = 45.6 bits (103), Expect = 6e-05 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 7/83 (8%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPX---PPXPXPPPXXPPXPPP 891 P P P PP P S PP PP P P PP P PPP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 322 Query: 892 P----XPXPXPXXXPXXXPPPPP 948 P P P P PPPPP Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPPP 345 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXX-PPXPPXXXPXXPPXXPPXP---- 884 P P PP PP P PP PP P PP P P Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 371 Query: 885 PPPPXXPXPPPXPXXXXPPPP 947 PPPP PP PPPP Sbjct: 372 PPPPPGRRPPSGKINPPPPPP 392 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 9/85 (10%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPX-----PXPPPXXPP-- 879 P P P P P P PPP PP P PPP P Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 367 Query: 880 --XPPPPXPXPXPXXXPXXXPPPPP 948 PPPP P P PPPPP Sbjct: 368 LGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P S P PPP PP P P P PPPP P P PPPPP Sbjct: 345 PISKPPTSTRSAPPP-PPGRAPQPLGGPPPPPPGRRP-PSGKINPPPPPPP 393 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP--- 890 P P PP PP P PP P PP PP P PP Sbjct: 233 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNS 292 Query: 891 --PPXXPXPPPXPXXXXPPPP 947 P PP PPPP Sbjct: 293 FTTQGPPLPPSRDQAPAPPPP 313 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXX----PXXXPPXXXPXPPPPPXPXXXPXXPPXXXP 937 P PP P P PP PP P PP PPPP P P P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP-PISKPPTSTRSAP 357 Query: 938 PPP 946 PPP Sbjct: 358 PPP 360 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 714 LYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXP---PXXPPXPPXXXPXXPPXXPPXP 884 L P + P PP PP P P PP PP P P P Sbjct: 300 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Query: 885 PP---PPXXPXPPPXPXXXXPP 941 PP P PPP P PP Sbjct: 360 PPGRAPQPLGGPPPPPPGRRPP 381 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P+ PP P PP P PP P P PP P Sbjct: 270 PPPPKRGSSNPPPPPTRG-PPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQV 328 Query: 900 XPXPPPXPXXXXPPPP 947 PPP PPPP Sbjct: 329 PLPPPPLRGQIAPPPP 344 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPP 891 P PPPPP PP P P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXP 900 PPPP PP P PPP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP--PXXPXPPPXPXXXXPPPP 947 PP P PP PP P P PPP P P P P PPPP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXX 929 PP P P P P PP P P P PPPPP PP Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPP-PSRDQVPLPPPPLRGQIAPPPPP-ISKPPTSTRS 355 Query: 930 XXPPPP 947 PPPP Sbjct: 356 APPPPP 361 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 6/79 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP--- 890 P + P PP PP P P P PP P PP PPP Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPP---PISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Query: 891 PP---XXPXPPPXPXXXXP 938 PP P PPP P P Sbjct: 380 PPSGKINPPPPPPPAMDKP 398 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP----XPP 887 P R P P PP P PP P PP P P Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 310 Query: 888 PPPXXPXPPPXP----XXXXPPPP 947 PPP PPP P PPPP Sbjct: 311 PPPLNATPPPPPPSRDQVPLPPPP 334 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXP-XXPPXXPPXPPPPPXXP 905 PR P PP PP P P P PP P P PPPPP Sbjct: 118 PRGPALKPPGFRTTAPPPKNSSP----PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGK 173 Query: 906 XPPP 917 PPP Sbjct: 174 PPPP 177 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP---X 920 PP PP P PP P P P P PPP PPP Sbjct: 197 PPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRG 256 Query: 921 PXXXXPPPP 947 P PPP Sbjct: 257 PTSGGEPPP 265 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +1 Query: 796 PXSXXPXXPXPP-----PPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P S P PP PPP PP P PP P P P PPPP Sbjct: 198 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 876 PXPPPPPXXPXPPPXPXXXXPPPP 947 P PPPPP P PP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXP 936 P P P P PPPP P P PPPP P P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Query: 937 PPPP 948 P PP Sbjct: 299 PLPP 302 Score = 36.3 bits (80), Expect = 0.037 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 4/80 (5%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP----XPP 887 P P P P PP P PP P P P PP P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP-PLRGQIAPPPPPISKPPTSTRSAP 357 Query: 888 PPPXXPXPPPXPXXXXPPPP 947 PPP P P P PPPP Sbjct: 358 PPP--PGRAPQPLGGPPPPP 375 Score = 35.5 bits (78), Expect = 0.064 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 13/79 (16%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPX----------PPPPPX 899 PP PP P PP PP P P P PPPPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPH 199 Query: 900 X---PXPPPXPXXXXPPPP 947 PPP PPPP Sbjct: 200 SRHGSAPPPPERSSGPPPP 218 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPX--SXXPXXPXPPPPPXP--PXPXPPPXXPPXPPPPX 897 P P P PP P + PPPPP PPP PPPP Sbjct: 160 PSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPP 219 Query: 898 PXPXPXXXPXXXPP 939 P P PP Sbjct: 220 PGRGPSQRSLAPPP 233 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPP 943 P PP PP PP P PP P PP P PP P Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 33.9 bits (74), Expect = 0.19 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 15/95 (15%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP--- 879 G T P P P PP PPPPP P PP P Sbjct: 127 GFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPM-GKPPPPSGNKPTFG 185 Query: 880 -------XPPPP-----XPXPXPXXXPXXXPPPPP 948 PPPP P P PPPPP Sbjct: 186 NSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 220 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P P P PP P P P PPP P PPP Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 861 PPXXPPXPPPPPXXPXPPPXP 923 PP PP PPPPP P P P Sbjct: 3 PPPPPPGPPPPPSAPSGPVKP 23 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPP 894 PPPPP P P P P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P P PP P PP PP P P PPP P PP P Sbjct: 195 PPPPHSRHGSAPPPPERSSG--PPPPP--PGRGPSQRSLAPPPTGSSRPLPAPPPGENRP 250 Query: 941 PP 946 PP Sbjct: 251 PP 252 Score = 32.3 bits (70), Expect = 0.60 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 11/91 (12%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPX-SXXPXXPXPPPP----------PXPPXPXP 861 S+ P P L PP P + P PPPP P P P Sbjct: 212 SSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP 271 Query: 862 PPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP PPP P P PP P Sbjct: 272 PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Score = 32.3 bits (70), Expect = 0.60 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 5/71 (7%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPX-----PXPX 915 P P PP P P PPP PP P PP P P Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Query: 916 XXPXXXPPPPP 948 PPPP Sbjct: 303 SRDQAPAPPPP 313 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 852 PXXPPXXPPXPPPPPXXPXPPP 917 P PP PP PP P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 GG G G G GGG GG GGG G GG GG Sbjct: 65 GGNLSSSSSSTGGGGGFSGGG-GGSMGGG-GLGGLFAGG 101 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 835 PPXPPXPXPPPXXPPXPPPPXPXPXP 912 PP PP P PPP PP P P P Sbjct: 2 PPPPPPPGPPP--PPSAPSGPVKPPP 25 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 859 PPPXXPPXPPPPXPXPXPXXXP 924 PPP PP PPPP P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKP 23 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 828 PPXPPXXXPXXPPXXPPXPPPPP 896 PP PP P PP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPP 879 P P PP PP PP P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 877 PXPPPPXPXPXPXXXPXXXPPPPP 948 P PPPP P P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPP 879 P P P PPP P P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXP--XXXPPPPP 948 P P PPP P PPP PPPP P PPPPP Sbjct: 121 PALKPPGFRTTAPPPKNSSP-PPPFG--APPPPDRGGQLAKKPSQGSFPPPPP 170 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 9/46 (19%) Frame = +3 Query: 837 PPXXXPXXPPXXPPXPPPPPXXPXPP---------PXPXXXXPPPP 947 PP PP PPPP P PP P PPPP Sbjct: 125 PPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 170 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPX---P 885 S P P P P P P P P PPP P PP P P Sbjct: 116 SAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEP 175 Query: 886 PPPXPXPXPXXXPXXXPPPPP 948 PPP P P PPPPP Sbjct: 176 PPPKNAPPPPKRGSSNPPPPP 196 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXP----PXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPP 942 PP P P PPPPP P P PPP PPP P P PPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-PPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Query: 943 PP 948 PP Sbjct: 272 PP 273 Score = 45.6 bits (103), Expect = 6e-05 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 7/83 (8%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPX---PPXPXPPPXXPPXPPP 891 P P P PP P S PP PP P P PP P PPP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 234 Query: 892 P----XPXPXPXXXPXXXPPPPP 948 P P P P PPPPP Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPPP 257 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXX-PPXPPXXXPXXPPXXPPXP---- 884 P P PP PP P PP PP P PP P P Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 283 Query: 885 PPPPXXPXPPPXPXXXXPPPP 947 PPPP PP PPPP Sbjct: 284 PPPPPGRRPPSGKINPPPPPP 304 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 9/85 (10%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPX-----PXPPPXXPP-- 879 P P P P P P PPP PP P PPP P Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 279 Query: 880 --XPPPPXPXPXPXXXPXXXPPPPP 948 PPPP P P PPPPP Sbjct: 280 LGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P S P PPP PP P P P PPPP P P PPPPP Sbjct: 257 PISKPPTSTRSAPPP-PPGRAPQPLGGPPPPPPGRRP-PSGKINPPPPPPP 305 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP--- 890 P P PP PP P PP P PP PP P PP Sbjct: 145 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNS 204 Query: 891 --PPXXPXPPPXPXXXXPPPP 947 P PP PPPP Sbjct: 205 FTTQGPPLPPSRDQAPAPPPP 225 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXX----PXXXPPXXXPXPPPPPXPXXXPXXPPXXXP 937 P PP P P PP PP P PP PPPP P P P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP-PISKPPTSTRSAP 269 Query: 938 PPP 946 PPP Sbjct: 270 PPP 272 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 714 LYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXP---PXXPPXPPXXXPXXPPXXPPXP 884 L P + P PP PP P P PP PP P P P Sbjct: 212 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Query: 885 PP---PPXXPXPPPXPXXXXPP 941 PP P PPP P PP Sbjct: 272 PPGRAPQPLGGPPPPPPGRRPP 293 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P+ PP P PP P PP P P PP P Sbjct: 182 PPPPKRGSSNPPPPPTRG-PPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQV 240 Query: 900 XPXPPPXPXXXXPPPP 947 PPP PPPP Sbjct: 241 PLPPPPLRGQIAPPPP 256 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP--PXXPXPPPXPXXXXPPPP 947 PP P PP PP P P PPP P P P P PPPP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXX 929 PP P P P P PP P P P PPPPP PP Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPP-PSRDQVPLPPPPLRGQIAPPPPP-ISKPPTSTRS 267 Query: 930 XXPPPP 947 PPPP Sbjct: 268 APPPPP 273 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 6/79 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP--- 890 P + P PP PP P P P PP P PP PPP Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPP---PISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Query: 891 PP---XXPXPPPXPXXXXP 938 PP P PPP P P Sbjct: 292 PPSGKINPPPPPPPAMDKP 310 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP----XPP 887 P R P P PP P PP P PP P P Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 222 Query: 888 PPPXXPXPPPXP----XXXXPPPP 947 PPP PPP P PPPP Sbjct: 223 PPPLNATPPPPPPSRDQVPLPPPP 246 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXP-XXPPXXPPXPPPPPXXP 905 PR P PP PP P P P PP P P PPPPP Sbjct: 30 PRGPALKPPGFRTTAPPPKNSSP----PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGK 85 Query: 906 XPPP 917 PPP Sbjct: 86 PPPP 89 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP---X 920 PP PP P PP P P P P PPP PPP Sbjct: 109 PPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRG 168 Query: 921 PXXXXPPPP 947 P PPP Sbjct: 169 PTSGGEPPP 177 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +1 Query: 796 PXSXXPXXPXPP-----PPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P S P PP PPP PP P PP P P P PPPP Sbjct: 110 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXP 936 P P P P PPPP P P PPPP P P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Query: 937 PPPP 948 P PP Sbjct: 211 PLPP 214 Score = 36.3 bits (80), Expect = 0.037 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 4/80 (5%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP----XPP 887 P P P P PP P PP P P P PP P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP-PLRGQIAPPPPPISKPPTSTRSAP 269 Query: 888 PPPXXPXPPPXPXXXXPPPP 947 PPP P P P PPPP Sbjct: 270 PPP--PGRAPQPLGGPPPPP 287 Score = 35.5 bits (78), Expect = 0.064 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 13/79 (16%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPX----------PPPPPX 899 PP PP P PP PP P P P PPPPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPH 111 Query: 900 X---PXPPPXPXXXXPPPP 947 PPP PPPP Sbjct: 112 SRHGSAPPPPERSSGPPPP 130 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPX--SXXPXXPXPPPPPXP--PXPXPPPXXPPXPPPPX 897 P P P PP P + PPPPP PPP PPPP Sbjct: 72 PSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPP 131 Query: 898 PXPXPXXXPXXXPP 939 P P PP Sbjct: 132 PGRGPSQRSLAPPP 145 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPP 943 P PP PP PP P PP P PP P PP P Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 33.9 bits (74), Expect = 0.19 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 15/95 (15%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP--- 879 G T P P P PP PPPPP P PP P Sbjct: 39 GFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPM-GKPPPPSGNKPTFG 97 Query: 880 -------XPPPP-----XPXPXPXXXPXXXPPPPP 948 PPPP P P PPPPP Sbjct: 98 NSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPP 132 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P P P PP P P P PPP P PPP Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P P PP P PP PP P P PPP P PP P Sbjct: 107 PPPPHSRHGSAPPPPERSSG--PPPPP--PGRGPSQRSLAPPPTGSSRPLPAPPPGENRP 162 Query: 941 PP 946 PP Sbjct: 163 PP 164 Score = 32.3 bits (70), Expect = 0.60 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 11/91 (12%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPX-SXXPXXPXPPPP----------PXPPXPXP 861 S+ P P L PP P + P PPPP P P P Sbjct: 124 SSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP 183 Query: 862 PPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP PPP P P PP P Sbjct: 184 PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Score = 32.3 bits (70), Expect = 0.60 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 5/71 (7%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPX-----PXPX 915 P P PP P P PPP PP P PP P P Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Query: 916 XXPXXXPPPPP 948 PPPP Sbjct: 215 SRDQAPAPPPP 225 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXP--XXXPPPPP 948 P P PPP P PPP PPPP P PPPPP Sbjct: 33 PALKPPGFRTTAPPPKNSSP-PPPFG--APPPPDRGGQLAKKPSQGSFPPPPP 82 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 9/46 (19%) Frame = +3 Query: 837 PPXXXPXXPPXXPPXPPPPPXXPXPP---------PXPXXXXPPPP 947 PP PP PPPP P PP P PPPP Sbjct: 37 PPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 82 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/60 (46%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGG---GGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 GGGG G G G GG GG GG GGG GG GGGGG G G G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG-GGRRDYGGGSKGGG 241 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGGG G G G GG GG GG G GG GG GG G G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSS-RGGYGGGRGG---GGYGGGRGGGGGYGGGRRDYGGGSK 238 Query: 766 XG 761 G Sbjct: 239 GG 240 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G GG G G G G GGG GG G G G GGG G Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGG 815 G GG G GGG G G GGG GG G G G G GG Sbjct: 198 GYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXG-GGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXG 756 G G GGG G G GG GG GGG G G G G GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 31.9 bits (69), Expect = 0.79 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -3 Query: 922 GXGG--GXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXGXXGG 749 G GG G G GGGG GG G G GG G GG G G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGG--GGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -2 Query: 884 GXGGXXGGGX--GXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXGXXXXXXGXXG 720 G GG GGG G GG GG G G G G G G G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXP-PPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P PPPPP P P PP P PPPP P P P PPPPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP-----PEECPPPPP 591 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXX----PPXPPP-PPXXPXPPPXPXXXXPPPP 947 P P P P P PP PP PP P P PPP P PPPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P PP PP P P PP PP PP PPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPP 887 P P P PP P PP P PP P P PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 P P P P PP P P PPP PP PP P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 PP P P P P PP P PP PP PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 832 PPPXPPXPXPPPXXPPXPPP--PXPXPXPXXXPXXXPPPPPXP 954 P P P PP PPP P P P PPPPP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P PP PP P P P P P PPPP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLP-PSEDPKPPPPPPEPP 583 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 796 PXSXXPXXPXPPP-PPX--PPXPXPPPXXPPXPPPPXP 900 P P PPP PP P P PPP P PPP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 827 PPXPPXX--PXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 PP PP P PP P PPPPP P PPP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPE-------PPEECPPP 589 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +1 Query: 826 PPPPPXPPX-PXPPPXXPPXPPPP----XPXPXPXXXPXXXPPPPPXP 954 PP PP PP P P PP PPPP P P P PPPPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPP-XXPPXPPPPXPXP 906 PP P P PPPP P P PP PP PPP P P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 PP P P P PP P PP PP PP PP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P P PP P P PP PP P P P PP PPPP Sbjct: 161 PPQPPAPPAAPFMAPAAPP-APPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPP--PPPXXPXPPPXP 923 PP P P PP PP P P PP PP PP P PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPP---PPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP P P P PP P PP P PP P PPPP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP----PPPP 206 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P PP P + PP PP P P PP P PP P P P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 863 PXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 P PP PP P P P P PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPP 182 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G GGG G G G G G GG GG G GG GG G G G GG Sbjct: 151 GDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGG-XGGXXGGGXGXGGXGGGGG-XGXXGXXXXGXXXXX 780 G G G G G G G G GGG GG G G G G GGG G G G Sbjct: 135 GDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 Query: 779 GGXXXXXGXG 750 G G G Sbjct: 195 GDDGGSDGGG 204 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGG--GGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXG 779 GG G GGG GGG GG GG GG G G GG GG G G G Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSG-GGGDDGGSDGGGGGNDGGRDDGG 215 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 GG G G G G GGG GG GG GG G GG G Sbjct: 170 GGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G GG GG GGG GG GGGG G G Sbjct: 167 GDGGGSNGSGGGDDGGDGGDD-GGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G GGG G G G G GG G GGG GG GG Sbjct: 174 GSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 4/86 (4%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXX----PXPPPPPXPPXPXPPPXXP 876 G+ P P P P PP P PPPPP PPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 877 PXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPPP P PPPPP P Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPP 369 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 5/87 (5%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPX---PPPPPXPPXPXPPPXXPP 879 G + P P P P P P P PPP P PPP P Sbjct: 312 GSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPV 371 Query: 880 XPPPPXPXPXPXXXP--XXXPPPPPXP 954 PPP P P P PPPPP P Sbjct: 372 GGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPP--XXPPXPPPP 893 P P PP P P P P PP PP PP P PPPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Query: 894 PXXPXPPPXP 923 P PPP P Sbjct: 398 PGRGAPPPGP 407 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PXXPXXXXXXPXPXX--LXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP---XP 885 P P P P PP P P PPPP PP PPP PP P Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP--PPVGGPPPPPPPIEGRP 385 Query: 886 PPPXPXPXPXXXPXXXPPPP 945 P P P P PPP Sbjct: 386 PSSLGNPPPPPPPGRGAPPP 405 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 4/85 (4%) Frame = +3 Query: 705 SWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXP----PXXPPXPPXXXPXXPPXX 872 S + P P PP PP P P PP PP PP Sbjct: 282 SLGIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Query: 873 PPXPPPPPXXPXPPPXPXXXXPPPP 947 PPPP PP PPPP Sbjct: 342 SRGAPPPPSMGMAPPPVGGAAPPPP 366 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/88 (31%), Positives = 30/88 (34%), Gaps = 10/88 (11%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP-----PPPPXPPXPXPPPXXPP 879 + P P P P PP + P P PPPP P PP Sbjct: 295 AAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMA 354 Query: 880 XPP-----PPXPXPXPXXXPXXXPPPPP 948 PP PP P P P P PPPPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGP--PPPPPP 380 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 4/80 (5%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX---PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP 890 P P PP PP P PP PP P P PP PP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPS 387 Query: 891 PPXXPXPPPXPX-XXXPPPP 947 P PPP P PP P Sbjct: 388 SLGNPPPPPPPGRGAPPPGP 407 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXP 937 P P PP P PP PP PP PPPPP P P P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 9/92 (9%) Frame = +3 Query: 699 PXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXP----PXPPXXXPXXPP 866 P S P P PP PP P PP P PP PP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 867 XXPPXPPP-----PPXXPXPPPXPXXXXPPPP 947 PPP PP P PPP PPPP Sbjct: 350 SMGMAPPPVGGAAPPP-PPPPPVGGPPPPPPP 380 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PPP PP P PP P P P P PP P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 10/74 (13%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPP--PPXPPXPXP--PP---XXPP 879 P P P + PP P P P PP PP PP P PP PP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAP----PPPPPPPVGGPPPPPPPIEGRPPSSLGNPP 393 Query: 880 XPPPP---XPXPXP 912 PPPP P P P Sbjct: 394 PPPPPGRGAPPPGP 407 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/70 (27%), Positives = 22/70 (31%) Frame = +1 Query: 676 PXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXP 855 P R G++ P P P + PP P PPPP PP Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGR 400 Query: 856 XPPPXXPPXP 885 PP P P Sbjct: 401 GAPPPGPMIP 410 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXX----PPXPPXXXPXXPPXXPPXPPPPPXXP 905 PP PP P P PP PP P PP PPP P P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 31.9 bits (69), Expect = 0.79 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPP 895 P P PP PP P PP P PP PPP P Sbjct: 364 PPPPPPPV-GGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPP----PPPXP 901 P P PP PP P PP P PP P PP PPP P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNP---PP---PPPPGRGAPPPGP 407 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -2 Query: 941 GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 GGG G G G G GGGG G GGG G GG GG GG G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGG-GDGGGGGDGGGG 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGX-GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GGGG G G G GGG GG GG G G GGGGG G G G G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGG-GGDGDGGGGGDGDGGGGGDGGGGGDG 109 Query: 776 G 774 G Sbjct: 110 G 110 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGG G G G GGGG G GGG G GG GGGG G Sbjct: 73 GGGDGGGCDGGGGDGDG---GGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGX----GGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXX 786 G GGGGG G G GGG GG GGG G GGG G G G G Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGD 108 Query: 785 XXGG 774 GG Sbjct: 109 GGGG 112 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = -3 Query: 913 GGXGXXGGGGGXG--GXXGGXXGXXXGGXGG---XXGGXGXXXXGXXXXGGXXXXGXXGG 749 GG G GGG G G G G GG GG GG G G GG G GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 748 XXXGXRGXXG 719 G G Sbjct: 108 DGGGGNDDDG 117 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -2 Query: 941 GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 GGG G G G G GGGG G GGG G GG GG GG G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGG-GDGGGGGDGGGG 127 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGX-GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GGGG G G G GGG GG GG G G GGGGG G G G G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGG-GGDGDGGGGGDGDGGGGGDGGGGGDG 124 Query: 776 G 774 G Sbjct: 125 G 125 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGG G G G GGGG G GGG G GG GGGG G Sbjct: 88 GGGDGGGCDGGGGDGDG---GGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGX----GGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXX 786 G GGGGG G G GGG GG GGG G GGG G G G G Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGD 123 Query: 785 XXGG 774 GG Sbjct: 124 GGGG 127 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = -3 Query: 913 GGXGXXGGGGGXG--GXXGGXXGXXXGGXGG---XXGGXGXXXXGXXXXGGXXXXGXXGG 749 GG G GGG G G G G GG GG GG G G GG G GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 748 XXXGXRGXXG 719 G G Sbjct: 123 DGGGGNDDDG 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 48.4 bits (110), Expect = 8e-06 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 6/59 (10%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP------XXXPXXXPPPPPXP 954 P S P P P PP P PPP PP PPPP P PPPPP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXP-------XPPPXXPPXPPPPXPXPXPXXXP 924 PP P P P PPPPP PP P PPPP P P P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPP----XPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P PP P P PP PP PP PPPPP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 36.3 bits (80), Expect = 0.037 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 15/65 (23%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP---------------PXXPXPPPXPXX 929 P P P PP P PP PP PPPP P P PPP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPA 147 Query: 930 XXPPP 944 PP Sbjct: 148 PCMPP 152 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 11/79 (13%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXP----------XPPPX 870 P P P P L P P PPPPP P P Sbjct: 108 PPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPP-PPPPPAPCMPPCHQTQVVHSVQLHA 166 Query: 871 XPPXPPP-PXPXPXPXXXP 924 PP PPP P P P P P Sbjct: 167 SPPGPPPAPMPAPPPMVVP 185 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P PPPP PPP PP P P P P PPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXP--XXXXPPPP 947 PP PP PP P PP PPP P PPP P PPPP Sbjct: 660 PPPPPPPPPGGQAGGAP--PPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXP---PXPXPPPXXPPXPPPPXP 900 PP P P PPPPP P P PPP PPPP P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPPPP PP PP PPPP P PPPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPG--------GAAPPPPPP 694 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 P P PP P PP P P PP PPPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPP 925 P PP PP PP PP P P PPPPP P PP Sbjct: 660 PPPPPP--PPPGGQAGGAPPPPPPPLPGGAAP-----PPPPPIGGGAPPPPP 704 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPP 866 P P PP PP P PP PP P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 48.0 bits (109), Expect = 1e-05 Identities = 36/120 (30%), Positives = 39/120 (32%), Gaps = 12/120 (10%) Frame = +3 Query: 621 RYQAXPLXXPSCALLFXPALXDXVXFPXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXX-- 794 RY PL P + P+L P + P PR P P P P Sbjct: 263 RYPPSPLRYPPIPPRYPPSLIRYPTLPPRYP--PSPPRYPPSPPRYPPSLHRYPQSPLRY 320 Query: 795 ---PXXXXPXPPXXPPXPPXXX---PXXPPXXPPXPPPPPXXPXP----PPXPXXXXPPP 944 P P P PP PP P PP P PP PP P PP P P P Sbjct: 321 PPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP PP P P P P P P PP P P PP Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 36.3 bits (80), Expect = 0.037 Identities = 35/115 (30%), Positives = 37/115 (32%), Gaps = 9/115 (7%) Frame = +1 Query: 637 PXXLPRALSCSXLPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPX 816 P P L +P R + P P P P PP P S Sbjct: 262 PRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYP-PSPPRYPPSLHRYPQSPLRY 320 Query: 817 XPXP---PP-----PPXPPX-PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PP PP PP P P PP PP P P P P P PP P Sbjct: 321 PPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPR-YP-PSPPRYPSSHPRYPPSP 373 Score = 36.3 bits (80), Expect = 0.037 Identities = 32/109 (29%), Positives = 35/109 (32%), Gaps = 3/109 (2%) Frame = +3 Query: 600 RNPTGL*RYQAXPLXXPSCALLFXPALXDXVXFPXSWXLYPXXP-RXPXXXPPXXPXXXX 776 R P L RY P P + P+ +P S YP P R P P Sbjct: 277 RYPPSLIRYPTLPPRYPPSPPRYPPS---PPRYPPSLHRYPQSPLRYPPSPIRYPPLPSR 333 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXP--PXXPPXPPPPPXXPXPPP 917 P P P PP PP P P P P PP P P P Sbjct: 334 YPPS--PPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Score = 35.9 bits (79), Expect = 0.048 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P PP P P P PP PP PP P PP PP P Sbjct: 262 PRYPPSPLRYPPIPPRYP-PSLIRYPTL----PPRYPPSPPRYPPS-PPRYPPSLHRYPQ 315 Query: 900 XPXP-PPXPXXXXPPP 944 P PP P P P Sbjct: 316 SPLRYPPSPIRYPPLP 331 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXP---XXPPXXPPXPPPPPXXPXPPP 917 P P P PP PP P P P PP PP P PP Sbjct: 261 PPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPP-----PXPXPXPXXXPXXXPPPPP 948 P PP PP P P PP PP P P P PP PP Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPP-PPXPP-XPXPPPXXPPXPPPPXPXP 906 P PP P S P PP PP PP P P PP P P P Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXP 937 P PP PP P PP PP P P PP P P PP P Sbjct: 259 PSPPRY--PPSPLRY----PPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 Score = 29.9 bits (64), Expect = 3.2 Identities = 36/134 (26%), Positives = 40/134 (29%), Gaps = 21/134 (15%) Frame = +3 Query: 600 RNPTGL*RYQAXPLXXPSCALLFXPALXDXVXFPXSWXL-YPXXPRXPXXXPPXXPXXXX 776 R P L RY PL P + + P P + +P P P PP P Sbjct: 305 RYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPS 364 Query: 777 --PPXXXXPXXXXPXPPXXPPXP---PXXXPXXPPXX---PPXP----------PPPP-- 896 P P P P PP P P PP PP PPPP Sbjct: 365 SHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPSHLRYPPSSLRYLPSHLRYPPPPLR 424 Query: 897 XXPXPPPXPXXXXP 938 P P P P Sbjct: 425 YPPSPLRYPPSLSP 438 Score = 29.9 bits (64), Expect = 3.2 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPPP--PPXPP-XPXPPPXXPPXPP--PPXP---XPXP 912 P + PP P S P P P PP PP P PP P P PP P P P Sbjct: 322 PSPIRYPPLPSRYPPSP-PRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Query: 913 XXXP 924 P Sbjct: 381 IRYP 384 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 5/68 (7%) Frame = +1 Query: 766 LXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP--PPXPXPXPXXXPXXXPP 939 L PP P P P PP PP PP PP PP P P Sbjct: 258 LPSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRY-PPSPPRYPPSPPRYPPSLHRYPQS 316 Query: 940 P---PPXP 954 P PP P Sbjct: 317 PLRYPPSP 324 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G GGGG GG GGG G GG GGGGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGG-GXGGXXGGGXGXGGXGGGGGXGXXG 810 GGG G G G G GGG G GG GGG G GGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGG 815 GGGG G GGG G GGGGG GG GG GG G GG Sbjct: 80 GGGGCG--GGGGGGGGVGGGGG-GGGGGGDDCEDGGGDDGEDGG 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGG G G G G GGGG GG G GG G G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGG 831 G GG GG G G G GGGG G G G G GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GG G GGG G GGGGG GG GG G GG GG G G Sbjct: 74 GGGDTDG-GGGCG--GGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGG 826 G GGG GG G G GGGG G GG GG G Sbjct: 76 GDTDGGGGCGGG--GGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGG-GGXGXXG 810 G GGGG G G G GG GG GGG G GG GGG GG G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGG-YGGGRGGGGYGGGRGGGGSYG 136 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGG 843 GGGG G G G GGGG GG GGG GG Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 941 GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 GGG G G GGGG GG GGG G GG GGGG G Sbjct: 312 GGGRGGGYRSG-----GGGGYGGGRGGGRGYGGGRGGGGRRDYG 350 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG-GXGGXXGGGXGXGGXGGGGGXG 819 G G GGG G G G G GGG G GG GGG G GGG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG-GRRDYGGGSRSG 356 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GGGG G G G GG GG GG G GG GG GG G G GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSS-RGGYGGGRGG---GGYGGGRGGGGSYGGGRRDYGG 144 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXG-GGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXG 756 G G GGG G G GG GG GGG G G G G GG G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 893 GGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 GGG GG GG G G G GGG G G G GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G G GG G G G G GGG GG GG G G GG Sbjct: 105 GGGYGGSSRGGYGGGRGGGGYGGGRGG--GGSYGGGRRDYGG 144 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGG 826 G GGG GG G G GGG G G G G GG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGG 815 G GG G GGG G G GGG G G G GG G Sbjct: 314 GRGGGYRSGGGGGYG-GGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 893 GGGGXGGXXGGG--XGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G GG GGG G GG GG G G G G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPP 943 PP PP PP P PP PPPPP P PP PPP Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPP---PPXP 954 PPPPP P PP PPPP P P P PPP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 PP P PP PP P PP P P PP P PP P P PP Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPP 1281 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 PP P P PP PP P PP P PPPP P PP P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPM-PPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +1 Query: 811 PXXPXPPPPPXPPX----PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PP PP P PPP P PP P P P PP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P P PPPP P PP PP PPP P P P PP P P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPP--QPPFMPPP-PRMQPPGPPGPPGPPGPQP 1291 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP 893 P P P PP PP P P PP PP PP P PP PP PP P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMP--PQPPFMPP-PPRMQPPGPP-GPPGPPGP 1289 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXP--PXXXPXXPPXXPPXPPPPPXXPXPPP 917 PP P P P P PP P P P P P PP PP PP P P P Sbjct: 1238 PPAMPPDGPPKFMGLP----PPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPP 891 P P P PP P P PPP PP P PP PP P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP-GPPGPQP 1291 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 PP P PP P P P PP P PPP P PP Sbjct: 1211 PPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 820 PXPPPPPXPPX--PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PPP P PPP PP PP P P P PP P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPP--PPGMRPMPPQP 1266 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 4/61 (6%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXP----PPXPXXXXPPP 944 PP P P PP PP P PP P PP P P P Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMP 1263 Query: 945 P 947 P Sbjct: 1264 P 1264 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +1 Query: 811 PXXPXPPPPPXP---PXPXPPPXXPPXP--PPPXPXPXPXXXP--XXXPPPPP 948 P PPP P PPP PPP P P P PPPPP Sbjct: 1205 PTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPP 1257 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = +1 Query: 712 LSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPP 891 + P P P P PP P P PP P P P P PP PP Sbjct: 279 IPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPN 338 Query: 892 PXPXPXPXXXPXXXPPPP 945 P P P P P PP Sbjct: 339 PSIPPAP-PNPSIPPAPP 355 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 5/80 (6%) Frame = +3 Query: 720 PXXPRXPXXX-PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXP----PXP 884 P P P PP P PP P P P P PP P PP P P Sbjct: 251 PLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPP--NPYIPPAPPNLFIPSA 308 Query: 885 PPPPXXPXPPPXPXXXXPPP 944 PP P P PP P PP Sbjct: 309 PPNPHIPPAPPNPYIPTAPP 328 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXP-PPPXPXPXPXXXPX 927 P P + PP P P P PP P P P P PP P P P P Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKA 239 Query: 928 XXPPPPPXP 954 P PP P Sbjct: 240 IATPNPPMP 248 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P P PP P P P PP PP P P PP PP Sbjct: 263 PASPNPSIPPAPPNPSIPAPPNPSIPLA--PPNPYIPPAPPNLFIPSAPPNPHIPPAPPN 320 Query: 900 XPXPPPXPXXXXPPPP 947 P P PP P Sbjct: 321 PYIPTAPPNPSIPPAP 336 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP P P P PP PP P P PP PP P P PP PP P Sbjct: 179 PPAPSTIPTPPTP--PAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP PP P PP PP PP PP P P PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPP 215 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP-- 894 P P P P PP P P P PP P P P PP PP P Sbjct: 179 PPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSK 238 Query: 895 -XPXPXPXXXPXXXPPPPPXP 954 P P PP P P Sbjct: 239 AIATPNPPMPETPLPPATPNP 259 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P PP P PP P P P PP P P PP PP Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 900 XPXPPPXPXXXXPPPP 947 P P PP P Sbjct: 303 LFIPSAPPNPHIPPAP 318 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPP---PXPPXPXPPPXXPPXPPPPXPXPXPXXX 921 P P PP P PP P P PP P PP P PP P Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPL 213 Query: 922 PXXXPPPPPXP 954 P P PP P Sbjct: 214 PPGSPHIPPAP 224 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = +1 Query: 718 TPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPX 897 TP P P P PP + P P P PP P P PP P P Sbjct: 211 TPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPP-ATPNPFIPPASPNPS 269 Query: 898 PXPXPXXXPXXXPPPPPXP 954 P P PP P P Sbjct: 270 IPPAPPNPSIPAPPNPSIP 288 Score = 41.9 bits (94), Expect = 7e-04 Identities = 33/108 (30%), Positives = 36/108 (33%), Gaps = 7/108 (6%) Frame = +1 Query: 646 LPRALSCSXLPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPX 825 LP A +P + S+ P P P P PP P P Sbjct: 252 LPPATPNPFIPPASPNPSIPPAPPNPSIPAP----PNPSIPLAPPNPYIPPAPPNLFIPS 307 Query: 826 PPP----PPXPPXPXPP--PXXPPXPP-PPXPXPXPXXXPXXXPPPPP 948 PP PP PP P P P P PP PP P P PP PP Sbjct: 308 APPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 3/82 (3%) Frame = +1 Query: 718 TPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXP-PPP 894 +P P P P P P P P PP P P P P P PP Sbjct: 196 SPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPA 255 Query: 895 XPXP--XPXXXPXXXPPPPPXP 954 P P P PP PP P Sbjct: 256 TPNPFIPPASPNPSIPPAPPNP 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPX 899 P P P PP P PP P P PP P PP P PP PP P Sbjct: 186 PTPPTPPA--PPSPPIPTAPPTPPMPET--PLPPGSPHIPPAPLH---PHIPPAPPNPSK 238 Query: 900 XPXPPPXPXXXXPPPP 947 P P P PP Sbjct: 239 AIATPNPPMPETPLPP 254 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXP-XPPPXXPPXP-PPP 894 P P P P P P P P PP PP P P P P P PP Sbjct: 233 PPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPP 292 Query: 895 XPXPXPXXXPXXXPPPPPXP 954 P P P PP P Sbjct: 293 NPYIPPAPPNLFIPSAPPNP 312 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = +1 Query: 712 LSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPP--PXXPPXP 885 ++TP P P P P P P P P P PP P P P P P Sbjct: 240 IATPNPPMPET--PLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIP 297 Query: 886 PPPXPXPXPXXXP-XXXPPPPPXP 954 P P P P PP PP P Sbjct: 298 PAPPNLFIPSAPPNPHIPPAPPNP 321 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXP-PXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPP 914 P PP P P P P P PP PP PP P PP P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAP-LHPHIP 230 Query: 915 PXP 923 P P Sbjct: 231 PAP 233 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXP--XPPPXXPPXPPPP 894 P P P P P P P P PP P P P P P P PP Sbjct: 224 PLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP 283 Query: 895 XP-XPXPXXXPXXXPPPP 945 P P P P PP Sbjct: 284 NPSIPLAPPNPYIPPAPP 301 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP-P 891 S P P P P L P P P P P P P P P PP P Sbjct: 286 SIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAP 345 Query: 892 PXPXPXPXXXPXXXPPPPP 948 P P P PP P Sbjct: 346 PNPSIPPAPPNLFIPPATP 364 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/94 (28%), Positives = 29/94 (30%), Gaps = 2/94 (2%) Frame = +1 Query: 673 LPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXP--PXXXXXPXSXXPXXPXPPPPPXP 846 +P L + P P P P P P S P P PP P Sbjct: 220 IPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSI 279 Query: 847 PXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P P P P PP P P P PP P Sbjct: 280 PAP-PNPSIPLAPPNPYIPPAPPNLFIPSAPPNP 312 Score = 37.5 bits (83), Expect = 0.016 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 5/70 (7%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP-----PPXXPXPP 914 PP P P P PP PP P PP PP PP P P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Query: 915 PXPXXXXPPP 944 P P PP Sbjct: 222 PAPLHPHIPP 231 Score = 37.1 bits (82), Expect = 0.021 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 6/86 (6%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPP----XPPXPXPPPXXPPX 882 ST P P P PP P P PP P PP P P Sbjct: 183 STIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIAT 242 Query: 883 PPPPXP-XPXPXXXP-XXXPPPPPXP 954 P PP P P P P PP P P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNP 268 Score = 35.5 bits (78), Expect = 0.064 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 7/82 (8%) Frame = +3 Query: 720 PXXPRXPXXXP-PXXPXXXXPPXXXX--PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPP 890 P P P P P P PP P P P PP P P P P P Sbjct: 194 PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLP 253 Query: 891 P----PXXPXPPPXPXXXXPPP 944 P P P P P PP Sbjct: 254 PATPNPFIPPASPNPSIPPAPP 275 Score = 34.7 bits (76), Expect = 0.11 Identities = 29/120 (24%), Positives = 33/120 (27%), Gaps = 2/120 (1%) Frame = +1 Query: 601 ETRXDYKDTRRXPXXLPRALSCSXLPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPP 780 ET +T+ P + P S + TP P P P Sbjct: 166 ETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPL 225 Query: 781 XXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPP-XPPPPXPXP-XPXXXPXXXPPPPPXP 954 P P P P P PP P PP P P P P P PP P Sbjct: 226 HPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P P P PP P PP PP P P PP P P PP Sbjct: 177 PKPPAPSTIPTPPTPPA-----PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Query: 941 PP 946 P Sbjct: 232 AP 233 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G G GGG GG GGG G GG GGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G G GGGG G GGG G GG G GGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXG-GXGGGGGXG 819 G G GGG G G G GGGG GG GGG G G G G G G G Sbjct: 304 GDGDGGGGGDG-----GGGGGGGGGGGGDGGGDGDGDGDGDGDGDG 344 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXG 794 GGG G GGG G GGGGG GG G G G G G G G Sbjct: 308 GGGGGDGGGGGGGG--GGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G GGG G G G G G GGG G G G G G G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 890 GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 G G G GGG G GG GGGGG G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 940 GGXXXXGXGGGXGX-XGGGGGXGGXXGGXXGXXXGGXGGXXGGXG 809 G G GGG G GGGGG GG GG G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXG 818 GGGG G GGG G G G G G G G G G G Sbjct: 314 GGGGGGGGGGGGGDG-GGDGDGDGDGDGDGDGDGDGDGDGDDG 355 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 2/71 (2%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGG--GGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXX 770 G G G GG G GG GG G GG G G GG GG G G G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSS 830 Query: 769 XXGXXGGXXXG 737 G GG G Sbjct: 831 SGGASGGADGG 841 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXG 761 GG G G G GG GG GG G GG GG G G G G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Query: 760 XXGGXXXGXRGXXG 719 GG G G Sbjct: 823 ASGGAGSSSGGASG 836 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G G G G GG GG GG G GG G G G GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G Sbjct: 823 ASGGAGSSSGGASGGADG 840 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGG--GGXGGXXGGGXGX-GGXGGGGGXGXXGXXXXGXXXXXG 777 GG GG G G G GG GG GG GG G GG GG G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Query: 776 G 774 G Sbjct: 841 G 841 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G GG G G G G GG GG G G G G G G G Sbjct: 789 GANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 2/71 (2%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGX--GXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXX 781 G G GG G G GG G G GG G GG GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSS 830 Query: 780 GGXGXXGXXGG 748 G G GG Sbjct: 831 SGGASGGADGG 841 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGGG G G G G G GGG G GG G G G G Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGGG G G G G G G G GG GGGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG 809 GGG G GGG G GGG G G G GG GG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGG GG GGG G GG G G G G G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 GGGGG G G G G G G G GG GGGGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGGG G G G G G G G GG GGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG 809 GGGG G GGG G G G G G G GG GG G G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 890 GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 GGG GG GGG G GG GG G G GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 942 GGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXG 796 GGG GG G G GGG G G G GG GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 916 GGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXG 779 GGG G GGGGG GG G G G G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 46.8 bits (106), Expect = 3e-05 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGG GG GGG G GG GGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = -2 Query: 905 GXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGGG GG GGG G GG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = -2 Query: 890 GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 GGG GG GGG G GG GGGGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGG 872 GGGG G GGG G GGGGG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXG 837 G GGGGG G G G GGGG GG GGG G G Sbjct: 53 GGGGGGG-------GGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXG 863 GGG G GGG G GGGGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGG 831 G GGGGG G G G G GGGG G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 923 GXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG 828 G G G G GGGG GG GGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PP PP PPP P PP P P P P PPP P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 811 PXXPXPPP--PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PPP P PP PPP P PP P P P P PPP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P + P P P PP PPP P PP P P P P PPP P Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/87 (34%), Positives = 30/87 (34%), Gaps = 5/87 (5%) Frame = +3 Query: 699 PXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPX--PPXXXPXXPPXX 872 P L P P P P PP P P PP PP PP P PP Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPP----PIPPIDPPRTQPPPIPPIDPPRT 205 Query: 873 --PPXPP-PPPXXPXPPPXPXXXXPPP 944 PP PP PP PP P P P Sbjct: 206 QPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = +3 Query: 672 PALXDXVXFPXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPP-XX 848 P + P + P + P P P PP PP P PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 849 XPXXPPXXPPXPPPPPXXPXP-PPXP 923 P PP PP PPP P P P P Sbjct: 207 PPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPP-XXXPXXPPXXPPXPPPPPXXPXPP 914 P P PP PP P PP P PP PP PPP P P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Query: 915 PXPXXXXPPP 944 P PP Sbjct: 203 PRTQPPPIPP 212 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 5/71 (7%) Frame = +1 Query: 757 PXXLXXPPXXXXXPXSXXPXXPXPP--PPPXPPXPXPP---PXXPPXPPPPXPXPXPXXX 921 P PP P P P PP PP P P PP P P P PP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPP-PIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPP 221 Query: 922 PXXXPPPPPXP 954 P P P P Sbjct: 222 PIFPQPTTPAP 232 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 826 PPPPPXPPXPXP-PPXXPPXPPPPXPXPX-PXXXPXXXPPPPP 948 P P P P PP P PP P P P P PPP P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIP 185 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGG 825 GGGG G G G G G GG GG GGG GG GGGGG Sbjct: 92 GGGGRRERG---GRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 945 GGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGG 793 GGGG G G G GGGGG G GG G GG GG G GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYG--GGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGGG G G G GGG G GGG GGGGG G Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGG---GGGFYQDSYGGGGGGG 142 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 GG G G G G G GG GG GGG GGGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 890 GGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXXXGXG 750 GGG GG G GG GGGGG G G G G G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGG 138 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G GGG G GG GGG G G GG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGG 815 GGGG G GGG G GGG GG GG G GG GG Sbjct: 103 GGGG----GYGGGGGYGGGGRSYGG-GGGGGGFYQDSYGGGGGG 141 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 819 PXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P PP P P PP P PPPPP PPP P PPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP----PPP 249 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P PPPP P P PP PP PPPP P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 835 PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P PP P PP P P P P P P PPPPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PP P P PPP P PPPP P PPPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPP---------PAAAPPPPPPP 247 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXP 924 P PP P P PPP P PPP P P P P Sbjct: 223 PTPPPPAAPAPPPP-PAAAPPPPPPPPPVKKP 253 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 853 PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P PPP P P P PPPPP P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 P P P PP PP PPP PP PPPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPP--PP-PPPPVKKP 253 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 P P P P PPPPP P PPP P P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P P PP PP P PPPP P PPP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPP--PPPPP 249 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXX--PXPPPXPXXXXPPPP 947 P P P PP P PP P PPP P PPPP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP 245 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 852 PXXPPXXPPXPPPPPX-XPXPPPXPXXXXPPPP 947 P P P PPPP P PPP PPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPX---PPPPPXXPXPPPXPXXXXPPPP 947 P P P P P PP PPPP PPP P PPPP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP----PPPP 249 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 860 PPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 P P PPPP P P PP PPPP Sbjct: 218 PDYLEPTPPPPAAPAPPP--PPAAAPPPP 244 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXP 911 P PP P PP P PP PPPPP P Sbjct: 225 PPPPAAPAPPP-----PPAAAPPPPPPPPPVKKP 253 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPP 895 PP P PP P P P PPPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPP 864 P P L P P P PPPPP PP P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPP---PPXP 954 P P P PP P P P P P PPP PP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPP 244 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXP 901 P P P PP PP PPPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXG-XGGXGGGGGXGXXGXXXXG 795 G G G G G G GG G GG GGG G GG GGG G G G G Sbjct: 427 GDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 953 GXGG-GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGG 825 G GG GGG G G G G GG GG GG G G G GGG Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -2 Query: 941 GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 GGG G G G G G GGG G GG G GGG G G G GG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDG-GGGGDGGGDGIDGGDGGGDGGGDGG 475 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXG--GGXGXGGXGGGGGXGXXGXXXXG 795 G G G G GGGG GG G GG G GG GGG G G G G Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDG-GGDGGGDGGGDGGGDGGG 484 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 46.0 bits (104), Expect = 5e-05 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXP--PPPXPXPXPXXXPXXXPPPPP 948 PPPPP P PP PP P PPP P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 820 PXPPP----PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPP 939 P PPP PP P P P P PP P P P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPP 891 P P PP P + P PPPP P P PP PP PP Sbjct: 124 PPPTGTLPPP-----PVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 853 PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PPP PPP P P P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 832 PPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PPP P PPP P PPP P P P PP P Sbjct: 122 PPPPPTGTLPPP--PVTPPPGPETPPPPDTPAPPVPPTEAP 160 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPP 925 PP P P PP P PP P PP PP P PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP-TEAPPTAPP 165 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPP 894 P P P P PPPP P P PP P PP Sbjct: 126 PTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP-PPPPXXPXPPPXPXXXXPPPP 947 P P PP PP P P PP P P PP P PP PP Sbjct: 126 PTGTLPPPPVTPPPGPETPP--PPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 PP P P P P PP P P PP PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP PP P PP PPPP P PP P P P Sbjct: 123 PPPPTGTLPPPPVTP--PPGPE--TPPPPDTPAPPVPPTEAPPTAP 164 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPP 878 PP PP P PP P PP PP PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 46.0 bits (104), Expect = 5e-05 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P PPPPP PP P P PP PPPP P P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 P + P P PPPPP P PPP PP PP P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +3 Query: 840 PXXXPXXPPXXPPXPPPPPXXPX---PPPXPXXXXPPPP 947 P PP PP PPPPP P PPP P PPPP Sbjct: 188 PSPMAGMPP--PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPP 914 P PP PP P P PP PPPP P PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPP 941 PP PP PP P P PPPPP PPP PP Sbjct: 195 PPPPPPPPPPGFPGGAP-----PPPPPPFGAPPPPALNGGPP 231 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 886 PPPXPXPXPXXXPXXXPPPPPXP 954 PPP P P P P PPPPP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPP 217 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPX--PPPPPXXPXPP 914 P P PP PP P PP PP PPPP PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPP 886 P PP PP P PP PP PP PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 P P PP P P PPPPP PPP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPF--GAPPPPALNGGPP 231 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 46.0 bits (104), Expect = 5e-05 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -2 Query: 911 GXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G G GGGG GG GGG G GG GGGGG G Sbjct: 338 GSGRGGGGGG-GGGGGGGGGGGGRGGGGGFSSRG 370 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -2 Query: 893 GGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 GG G GG GGG G GG GGGGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 938 GGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGG 831 GG G G G G GGGG GG GGG G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 923 GXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G G G GGGG GG GGG G GG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGG 860 GG G GGG G GGGGG GG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 893 GGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXG 795 G G GG GGG G GG GGGG G G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXG 839 GG G G GGG G GGGGG G GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G G GG GGG G GG GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXG 837 GG G G G G G GGGG G GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 916 GGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXG 809 GG GGGGG GG GG G GG G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P PPPPP PPP P P P P P PPPPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P PP P P PP PP P P PPP P PPP Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP----PPP 322 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 828 PPXPPXXXPXXPPXX---PPXPPPPPXXPXPPPXPXXXXPPPP 947 PP PP PP P PPPP P P P PPPP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPP--PLPAGVPAPPPPPPP 321 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +2 Query: 779 PXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPPP 946 P PP P PP P P PPPPP P P PP PPPP Sbjct: 276 PTSQPPPPPPLTGGMLPP-----PFGGHP--AAAPPPPPLPAGVPAPPP--PPPPP 322 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +3 Query: 795 PXXXXPXPPXXP----PXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXP 938 P P PP P P P P PP P P P PPP P P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPP 867 PP P + P P P P PP P PPP Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 776 PPXXXXPPXPXXXXXXXPP---XPPXXPXXXP-PXXXPXPPPPPXP 901 P PP P PP P P P P P PPPPP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPP 895 P P P P P P PP P P P PPPPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVP--APPPPPPPP 322 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXP 911 P PP P P P PP PP P P PP PPPPP P Sbjct: 276 PTSQPPPPPPLTG---GMLPPPFGGHPAAAPPPPPL--PAGVPAPPP-PPPPPMLGGP 327 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXP 900 PP P P PP P P P PPPP P Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPP 849 S P P P P P P PPPPP PP Sbjct: 278 SQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 9/48 (18%) Frame = +1 Query: 796 PXSXXPXXPXPP------PPPXPPXPXPPPXXPPXP---PPPXPXPXP 912 P S P P PP PPP P P PP P P P P P P Sbjct: 276 PTSQPP--PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXP-PXPXPPPXXPPXPPPPX 897 P P P P P P PPPP P P P PP P PP Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 898 PXPXPXXXPXXXPPPPP 948 P P P P PP Sbjct: 976 PPPPPPVQTTTAPTLPP 992 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 14/80 (17%) Frame = +3 Query: 750 PPXXPXXXXP----PXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXP----------P 887 PP P P P P P PP PP PP P P P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTR--PTVPTTPTTQASTTRPTP 951 Query: 888 PPPXXPXPPPXPXXXXPPPP 947 PPP PPP P PPPP Sbjct: 952 PPPTSALPPPIPATQVPPPP 971 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +1 Query: 715 STPXXPXXXXXXPXPXX-LXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPP 891 +TP P P P L PP P P P P PP P P P Sbjct: 904 TTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIP 963 Query: 892 PXPXPXPXXXPXXXPPPP 945 P P P PPPP Sbjct: 964 ATQVPPPPLPPLPPPPPP 981 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 10/89 (11%) Frame = +1 Query: 718 TPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXP---- 885 T P P P PP P P P P PPP PP P P P Sbjct: 890 TTTAPPTTPTTPKPTTPAPPP-----PLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQA 944 Query: 886 ------PPPXPXPXPXXXPXXXPPPPPXP 954 PPP P P PPPP P Sbjct: 945 STTRPTPPPPTSALPPPIPATQVPPPPLP 973 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +3 Query: 720 PXXPRXPXXXP--PXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP 893 P P P P P P PP P P PP PPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPI 962 Query: 894 PXXPXPPPXPXXXXPPPP 947 P PPP P PPPP Sbjct: 963 PATQVPPP-PLPPLPPPP 979 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 819 PXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P PP P P PPP P P PPP P PPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPP-PLPPPPPP 928 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPP-PXXPPXPPPPXPXPXPXXXPXXXPP 939 P P PPP P P PP P PP PPP P P P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 P P P P PP P P PP PPPPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P P P P PP P P P PPPPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 844 PPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PP P P P P P P P PPPP P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAP-PPPLPLAPEPPPPLP 923 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 P PPPPP PP PP PP P P Sbjct: 1112 PLPPPPP-PPTEIPPAQETFEGSPPCPSP 1139 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPX---PPPPXPXPXPXXX 921 P L PP P P PPP PP PP P PPP P P P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGG 287 Query: 922 --PXXXPPPPPXP 954 P PPPP P Sbjct: 288 MPPNMEQPPPPPP 300 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +3 Query: 762 PXXXXPPXXXXPXXXXPXPPXXPPX--PPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXX 935 P PP P P P PP PP P PP PPP PP Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPP 296 Query: 936 PPPP 947 PPPP Sbjct: 297 PPPP 300 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP--PPXPXPXPXXXPXXXPPPPP 948 PP P PPPP P P PP PP PP P P PPP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 949 XP 954 P Sbjct: 284 PP 285 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXX 929 PP PP P PP P PP P P PP PPP P P P Sbjct: 215 PPIQTSTSLPP-MIPPVGMLGHPPMGAPPPPHSMP-PPGMPPPGMMPPPGFP-PMGMPGM 271 Query: 930 XXPPPP 947 PPP Sbjct: 272 GGMPPP 277 Score = 35.9 bits (79), Expect = 0.048 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPX---PPXXXPXXPPXXPPXPPPPPXXPX 908 P PP P P P P PP PP P P PPP P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 909 PPPX-PXXXXPPPP 947 PP P PPP Sbjct: 284 PPGGMPPNMEQPPP 297 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +3 Query: 738 PXXXPPXX-PXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP 893 P PP P PP P P PP PP P P P PPPP Sbjct: 250 PGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMP--PNMEQPPPPPP 300 Score = 30.3 bits (65), Expect = 2.4 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 13/66 (19%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPX---------PPXXXPXXPPXXPP---- 878 P PP P PP P P PP PP PP P PP P Sbjct: 237 PMGAPP--PPHSMPPPGMPPPGMMP-PPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNME 293 Query: 879 XPPPPP 896 PPPPP Sbjct: 294 QPPPPP 299 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 G G GGG G G G G G G G G G GG GGGG G Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXLXQR 432 +C G +PLPRSLTR ARSF CGER L R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGG----XGGGGGXGXXGXXXXGXXX 786 G GGG G G G GGG GG GGG GG GGG G G G G Sbjct: 133 GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG 192 Query: 785 XXGGXXXXXGXGXXXXXXGXXG 720 GG G G G Sbjct: 193 GMGGGMMEGMQGMGSMGGGMMG 214 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 5/71 (7%) Frame = -2 Query: 953 GXGGG-GGXXXGXXXGXGX-GXGGGGXGGXXGGGXG---XGGXGGGGGXGXXGXXXXGXX 789 G GGG GG G G G GGG GG GGG G GG GGG G G G Sbjct: 152 GMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGG 211 Query: 788 XXXGGXXXXXG 756 GG G Sbjct: 212 MMGGGMGGGMG 222 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG---GXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXX 783 G G GGG G G G GGG G G G G G G GGG G G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG 234 Query: 782 XGGXXXXXG 756 GG G Sbjct: 235 MGGGMLQMG 243 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/71 (35%), Positives = 25/71 (35%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXXG 761 GG GGG G GGG GG GG G G G G G G GG G Sbjct: 167 GGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQG-MGSMGGGMMGGGMGGGMGFNG 225 Query: 760 XXGGXXXGXRG 728 G G G Sbjct: 226 MEDGGKEGGMG 236 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -2 Query: 941 GGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGGXXXX 762 GGG G G G G GG GG G G G GGG G G GG Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG 234 Query: 761 XGXG 750 G G Sbjct: 235 MGGG 238 Score = 37.9 bits (84), Expect = 0.012 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 4/70 (5%) Frame = -2 Query: 953 GXGGG--GGXXXGXXXGX-GXGXGGGGX-GGXXGGGXGXGGXGGGGGXGXXGXXXXGXXX 786 G GGG GG G G G G GGG GG GGG G G GG G G Sbjct: 185 GMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGD 244 Query: 785 XXGGXXXXXG 756 GG G Sbjct: 245 SNGGGMSEMG 254 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG-GXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G GG G G GGG GG GGG GG GGG G G G Sbjct: 115 GPSEGGLMQKQFIEGGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMA 174 Query: 776 GXXXXXGXG 750 G G G Sbjct: 175 GGGMGGGMG 183 Score = 35.9 bits (79), Expect = 0.048 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXXX 764 GGG G G GGG GG GG G GG G G G G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGM 221 Query: 763 GXXGGXXXGXRGXXG 719 G G G G G Sbjct: 222 GFNGMEDGGKEGGMG 236 Score = 35.5 bits (78), Expect = 0.064 Identities = 28/85 (32%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Frame = -2 Query: 953 GXGGG---GGXXXGXXXGXGXGXGGGGXGGXXGGGXGXG--GXGGGGGXGXXGXXXXGXX 789 G GGG GG G G G GGG GGG G G G GGG G G Sbjct: 143 GMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGM 202 Query: 788 XXXGGXXXXXGXGXXXXXXGXXGVE 714 G G G G+E Sbjct: 203 QGMGSMGGGMMGGGMGGGMGFNGME 227 Score = 35.1 bits (77), Expect = 0.084 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 947 GGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 GG GG G G G GGG G GGG G GG G G G GG Sbjct: 129 GGEGGMGGGM--SMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGG 184 Score = 35.1 bits (77), Expect = 0.084 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 2/72 (2%) Frame = -3 Query: 946 GGG--GXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGX 773 GGG G GGG G GGG GG GG G G G G G Sbjct: 167 GGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGM 226 Query: 772 XXXGXXGGXXXG 737 G GG G Sbjct: 227 EDGGKEGGMGGG 238 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -2 Query: 944 GGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXG 810 GG G G G G GGGG GG GGG GG GGGG G G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGG-GGYRGGGGYGGGHRGGGGYGGGG 792 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGG G G G G GG GG GG G GG GGGG G G G Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGG-GGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGY 810 Query: 773 XXXXXGXG 750 G G Sbjct: 811 GQGSGGYG 818 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGG-GXGXXGXXXXGXXXXXG 777 G GGG G G GGG GG GG G G GGGG G G G G G Sbjct: 736 GYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRG 795 Query: 776 G 774 G Sbjct: 796 G 796 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGGG G G GGGG GG G G G G G G GG Sbjct: 764 GYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Query: 773 XXXXXG 756 G Sbjct: 824 YNRNTG 829 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXG-XXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGG G GG G GGGG GG G G GG G GG G G G Sbjct: 774 GGGGYGGGHRGGGG-YGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGGYNRNTGYNT 832 Query: 766 XGXXG 752 G G Sbjct: 833 YGSYG 837 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G GGGG G GG G GGG GG GGGG G G G GG Sbjct: 730 GGRGGGGYGGGYNDRR---MQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGG 786 Query: 773 XXXXXG 756 G Sbjct: 787 GYGGGG 792 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXXX 767 GGGG G GGG GGG G G GG G G G G G G Sbjct: 761 GGGGY---GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGY 817 Query: 766 XGXXGG 749 GG Sbjct: 818 GQGSGG 823 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXG-XXGGXGGXXXXXXXGXGGXXXXG 778 G GGG GG G G GGGG G G GG G G GG Sbjct: 770 GGYRGGGGYGGGHRG-GGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGGYNRNT 828 Query: 777 GXGXXGXXG 751 G G G Sbjct: 829 GYNTYGSYG 837 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGGXXXGXXGGXGGXXXXXXXGXGGXXXXGG 775 G GGG G GGG GG G GG GG GG GG Sbjct: 734 GGGYGGGYNDRRMQQGGYGNRSGGG---YRGG---GGYGGGGGGYRGGGGYGGGHRGGGG 787 Query: 774 XGXXGXXGG 748 G G GG Sbjct: 788 YGGGGHRGG 796 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 6/84 (7%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXP----PX 882 P P P PP P P P P PPP P P PPP P P Sbjct: 444 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPP 503 Query: 883 PPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P P PPP P Sbjct: 504 PGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 6/84 (7%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP--PPPPXPPXPXPPPXXP----PX 882 P P P PP P P P P PPP P PPP P P Sbjct: 454 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPP 513 Query: 883 PPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P P PPP P Sbjct: 514 PGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 6/84 (7%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXP-PXPPP 891 P P P PP P P P P PPP P P PPP P P PP Sbjct: 494 PGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Query: 892 P---XPXPXPXXXPXXXPPPPPXP 954 P P P P PPP P Sbjct: 554 PGASHPRVPPPGAPHPRVPPPGAP 577 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXP----PXPPPPXPXPXPXXXPXXXP 936 PP P P P P PPP P P PPP P P P P P P P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 491 Query: 937 PPPPXP 954 PPP P Sbjct: 492 PPPGAP 497 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 G P P P P P + P P PP P P P P P PP Sbjct: 525 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVP-PPGAPHPRVPPPGAPHPRVPP 583 Query: 889 P--PXPXPXPXXXPXXXPPPPPXP 954 P P P P P PPP P Sbjct: 584 PGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 2/77 (2%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXP-XPPXXPPXPPXXXPXXP-PXXPPXPPPP 893 P P P PP P PP P P PP P P P P P PP P Sbjct: 424 PGAPH-PRVPPPGAPHPRFPP----PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 478 Query: 894 PXXPXPPPXPXXXXPPP 944 P P PP P PPP Sbjct: 479 PRVP-PPGAPHPRVPPP 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 G P P P P P + P P PP P P P P P PP Sbjct: 425 GAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVP-PPGAPHPRVPPPGAPHPRVPP 483 Query: 889 P--PXPXPXPXXXPXXXPPPPPXP 954 P P P P P PPP P Sbjct: 484 PGAPHPRVPPPGAPHQRVPPPGAP 507 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P P PP P P PP P P Sbjct: 434 PGAPH-PRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHPR 490 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 491 VPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P P PP P P PP P P Sbjct: 474 PGAPH-PRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHPR 530 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 531 VPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P P PP P P PP P P Sbjct: 484 PGAPH-PRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHPR 540 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 541 VPPPGAPHPRVPPPGASHPRVPPP 564 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXP----PXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P PP P P P P PP P P Sbjct: 464 PGAPH-PRVPPPGAPHPRVPPPGA-PHPRVP-PPGAPHQRVPPPGAPHPRVPPPGAPHPR 520 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 521 VPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXPPXPPPP 894 P P P PP P P P PPP P P PPP P PP Sbjct: 474 PGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 533 Query: 895 XPXPXPXXXPXXXPPPPPXP 954 P P P P P P Sbjct: 534 PGAPHPRVPPPGAPHPRVPP 553 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXP----PXXPPXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P P P PP P P PP P P Sbjct: 514 PGAPH-PRVPPPGAPHPRVPPPGA-PHPRVPPPGAPHPRVPP-PGASHPRVPPPGAPHPR 570 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 571 VPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXP----PXXPPXPPXXXPXXPPXXPPXP- 884 P P P PP P PP P P P P PP P P PP P P Sbjct: 524 PGAPH-PRVPPPGAPHPRVPPPGA-PHPRVPPPGASHPRVPP-PGAPHPRVPPPGAPHPR 580 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 581 VPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXP----PXPPPPXPXPXPXXXPXXXP 936 PP P P P PPP P P PPP P P P P P P P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 471 Query: 937 PPPPXP 954 PPP P Sbjct: 472 PPPGAP 477 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXX--PPXXPPXP--P 887 P P P PP P PP P P PP P PP P P P Sbjct: 454 PGAPH-PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVP 512 Query: 888 PP--PXXPXPPPXPXXXXPPPP 947 PP P PPP PPP Sbjct: 513 PPGAPHPRVPPPGAPHPRVPPP 534 Score = 38.7 bits (86), Expect = 0.007 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 6/76 (7%) Frame = +3 Query: 738 PXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXX--PPXXPPXP--PPP--PX 899 P PP P PP P P PP P PP P P PPP P Sbjct: 399 PRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 900 XPXPPPXPXXXXPPPP 947 PPP PPP Sbjct: 459 PRVPPPGAPHPRVPPP 474 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXP----PXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPP 887 P P P PP P P P P P P PP P P P P Sbjct: 504 PGAPH-PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVP 562 Query: 888 PP--PXXPXPPPXPXXXXPPPP 947 PP P PPP PPP Sbjct: 563 PPGAPHPRVPPPGAPHPRVPPP 584 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPP 888 G P P P P P + P P PP P P P P P PP Sbjct: 435 GAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP-PPGAPHPRVPPPGAPHPRVPP 493 Query: 889 P--PXPXPXPXXXPXXXPPPPPXP 954 P P P P PPP P Sbjct: 494 PGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = +3 Query: 696 FPXSWXLYPXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPX-PPXXPPXPPXXXPXXPPXX 872 FP +P P P P P P P PP P P P P Sbjct: 441 FPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQR 500 Query: 873 PPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP P PPP PPP Sbjct: 501 VP-PPGAPHPRVPPPGAPHPRVPPP 524 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPXPPPXXPPXPPPPX 897 P P P P P P P P PPP P P PP P P P Sbjct: 404 PGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPP 463 Query: 898 PXPXPXXXPXXXPPPPPXP 954 P P PP P P Sbjct: 464 PGAP---HPRVPPPGAPHP 479 Score = 36.7 bits (81), Expect = 0.028 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 8/86 (9%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPXPPPXX-------P 876 P P P PP P P P PPP P P PP P Sbjct: 364 PDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRP 423 Query: 877 PXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P P PP P P Sbjct: 424 PGAPHPRVPPPGAPHPRFPPPGAPHP 449 Score = 36.7 bits (81), Expect = 0.028 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 5/81 (6%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXP-PXPPXXXPXXPPXXPPXP--PP 890 P P P PP P P P P P P PP P P PP Sbjct: 404 PGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPP 463 Query: 891 P--PXXPXPPPXPXXXXPPPP 947 P P PPP PPP Sbjct: 464 PGAPHPRVPPPGAPHPRVPPP 484 Score = 35.5 bits (78), Expect = 0.064 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXX-PXXPPXXPPXP 884 P P P PP P PP P P P PP P P P P Sbjct: 564 PGAPH-PRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLP 622 Query: 885 PP-PPXXPXPPPXPXXXXPPPP 947 PP PP PPP P P Sbjct: 623 PPGPPYQRVPPPGAPIQRVPLP 644 Score = 35.1 bits (77), Expect = 0.084 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 2/82 (2%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP--PPPPXPPXPXPPPXXPPX 882 G P P P P P + P P P P P PP P P PP Sbjct: 545 GAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Query: 883 PPPPXPXPXPXXXPXXXPPPPP 948 P P PPP P Sbjct: 605 GAPYQRLPYSGAYHPRLPPPGP 626 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPP-PPPXPPXP-XPPPXXP----PXPPPPXPXPXPXXXPXXXP 936 PP P P P P PPP P P PPP P P P P P Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRV 631 Query: 937 PPPPXP 954 PPP P Sbjct: 632 PPPGAP 637 Score = 33.1 bits (72), Expect = 0.34 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 6/84 (7%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP--PPPPXPPXPXPPPXXP-P-XPP 888 P P P P P P P P PPP PP P P PP Sbjct: 374 PGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPP 433 Query: 889 PPXPXP--XPXXXPXXXPPPPPXP 954 P P P P P PPP P Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAP 457 Score = 32.7 bits (71), Expect = 0.45 Identities = 29/94 (30%), Positives = 29/94 (30%), Gaps = 18/94 (19%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXP----PXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPP 887 P P P PP P P P P P PP P P PP P P Sbjct: 544 PGAPH-PRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP--HPRVPPPGAPHPK 600 Query: 888 -PPPXXP-------------XPPPXPXXXXPPPP 947 PPP P PPP P PPP Sbjct: 601 VPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPP 634 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 PP PP PPP PP P P P PP P Sbjct: 312 PPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYP 354 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 859 PPPXXPPXPP--PPXPXPXPXXXPXXXPPPPP 948 PPP P P PP P P P PPPP Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPP 331 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 3/71 (4%) Frame = +1 Query: 751 PXPXXLXXP---PXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXX 921 P P + P P P P PPPP P PP P P P Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSH-- 357 Query: 922 PXXXPPPPPXP 954 PPP P Sbjct: 358 -YSRVPPPDGP 367 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 P PPP P P P P PPP P P PPPP Sbjct: 297 PGYPPPQYMPHPRMRP--PTRIPPPGMGP-----PPRIPPPP 331 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXP--PPP--PXPPXPXPPPXXPPXPPP--PXPXPXPXXXPXXXP 936 PP P + P P P PPP P P P P P PPP P P P P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGD 112 Query: 937 PPPPXP 954 PPP P Sbjct: 113 PPPNTP 118 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXP--PPP--PXPPXPXPPPXXPPXPPP--PXPXPXPXXXPXXXP 936 PP P P P P PPP P P P P P PPP P P P P Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGN 92 Query: 937 PPPPXP 954 PPP P Sbjct: 93 PPPNTP 98 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP- 884 P P PP P PP P P P PP P P PP P P Sbjct: 34 PPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPI--PGDPPPNTPIPG 91 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 92 NPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPP-PPPXPPXPX-PPPXXP----PXPPPPXPXPXPXXXPXXXPP 939 P P P P P PPP P P PPP P P P P P P P P Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP 103 Query: 940 PPPXP 954 PP P Sbjct: 104 PPNTP 108 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP-PPPPXPPXPX-PPPXXP-PXPPP 891 P P P PP P P P P PPP P P PPP P P PP Sbjct: 45 PNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Query: 892 PXPXPXPXXXPXXXP 936 P P P P P Sbjct: 105 PN-TPIPGDPPPNTP 118 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP-PPPXPPXPXPPPXXPPXPPPPX 897 P P P PP P P P P PPP P P PP P P P Sbjct: 55 PNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPP 114 Query: 898 PXPXPXXXPXXXP 936 P P P Sbjct: 115 PNTPIQGDPLTIP 127 Score = 36.7 bits (81), Expect = 0.028 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 6/82 (7%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX-PXXXXPXPPXXPPXPPXXX-PXXPPXXPPXP--P 887 P P PP PP P P P PP P PP P P P Sbjct: 14 PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDP 73 Query: 888 PP--PXXPXPPPXPXXXXPPPP 947 PP P PPP PPP Sbjct: 74 PPNTPIPGDPPPNTPIPGNPPP 95 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP-PPPPXPPXPXPPPXXPPXP 885 G P P P PP P + P P P PPP P P PP P Sbjct: 61 GNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQ 120 Query: 886 PPPXPXP 906 P P Sbjct: 121 GDPLTIP 127 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXX----PXXXXPXPPXXPPXPPXXXPXXPPXXPPXP- 884 P P PP PP P P PP P P PP P P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPI--PGDPPPNIPIPG 61 Query: 885 -PPP--PXXPXPPPXPXXXXPPPP 947 PPP P PPP PPP Sbjct: 62 NPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 6/66 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXP-PPPPXPPXPXP-PPXXPP--XPPP--PXPXPXPXXXPXXXP 936 PP P P P PPP P PP P PPP P P P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGD 72 Query: 937 PPPPXP 954 PPP P Sbjct: 73 PPPNTP 78 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXP-PPPP 896 P P PP P PP P P PP P P PP P P PPP Sbjct: 64 PPNTPIPGDPPPNTPIPGDPP------PNTPIPGNPPPNTP--IPGDPPPNTPIPGDPPP 115 Query: 897 XXP 905 P Sbjct: 116 NTP 118 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 4/47 (8%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPP----PXPXPXPXXXPXXXPPPPPXP 954 PP P P P P PPP P P P PP P P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIP 50 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = +1 Query: 826 PPPPPXPPXPXP-----PPXXPPXPPPP--XPXPXPXXXPXXXPPPPPXP 954 PPPPP PP P PP PPP P P P PPPPP P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPX-PXXXXPPPP 947 PP P PP PP PP PPP P PPP P PPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPP----PXPPXPXPPPXXPPXPPPP 894 PP + P PPPP P PP P P PP PPPP Sbjct: 286 PPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 37.5 bits (83), Expect = 0.016 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 12/60 (20%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPP--------XPPPPXP----XPXPXXXPXXXPPPPPXP 954 P P PP P PPP P PPPP P P P P PPPP P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +3 Query: 729 PRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPX 908 P P P PP P PP PP PP PP P P P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP--TDFAPP--PPPPEPTSELPP 324 Query: 909 PPPXP 923 PPP P Sbjct: 325 PPPPP 329 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 11/61 (18%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXP-----PXXXPXPPPP------PXPXXXPXXPPXXXPP 940 PP P PP PP P P P PPPP P P P PP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Query: 941 P 943 P Sbjct: 329 P 329 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPP 925 P PP P PP PP PP PP P P PP Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP----PPEPTSELPPPPPPP 329 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = +3 Query: 330 GRGGLRIGXXXXXXXXXXXXXXXXXXXXXXXXXKAVIRLSTESGDNAGKNM 482 G GGLRIG KAVIRLSTESGDNAGKNM Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 829 PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P PP P PPP PP PPPP P P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 840 PXXXPXXPPXXPPXPPPPPXXPXPPP 917 P P PP PP PPPPP P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPP 891 P P PP PP P PPP PP PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 832 PPPXPPXPXPPPXXPPXPPPPXPXP 906 P P P P PPP PP PPPP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPP 894 P P P PP P PPP PP PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPPPPXP 900 P P P P P PPP PP PPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 811 PXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXP 936 P PPPPP PP P PPP PP P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 852 PXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P P PP PPPPP P PPP PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP------PPPP 885 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPP 867 P P P PPPPP PP P PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 853 PXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P PP PPPP P P P PPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPP--------PPPPPP 885 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 831 PXPPXXXPXXPPXXPPXPPPPPXXPXPP 914 P P P PP PP PPPPP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP--PPPP 885 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXPPPPP 896 P P P PP P PP PP PPPPP Sbjct: 860 PRPRPRRPPPP---PPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 8/65 (12%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXP---PXPXPPPXXPPXP-----PPPXPXPXPXXXPXXX 933 P P S P P P P P P P P P P P P P P P Sbjct: 463 PSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSE 522 Query: 934 PPPPP 948 P P P Sbjct: 523 PSPNP 527 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXP-PXPXPPPXXPPXP-PPPXPXPXPXXXPXXXPPPPPXP 954 P S P P P P P P P P P P P P P P P P P Sbjct: 459 PISNPSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSP 513 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 778 PXXXXXPXSXXPXXPXPPPPPXPP 849 P P P P PPPPP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXP 906 P P P PPPPP PP P P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXLXQR 432 +C G +PLPRSLTR ARSF CGER +R Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKMAYER 107 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFNCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXG-GGGXGGXXGGGXGXGGXGG-----GGGXGXXGXXXXGX 792 G G G G G G G G G GGG G GGG G G GG GGG G G Sbjct: 7 GWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMG-RGPGGGWG 65 Query: 791 XXXXGGXXXXXGXGXXXXXXGXXG 720 GG G G G G Sbjct: 66 RMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/76 (36%), Positives = 28/76 (36%), Gaps = 1/76 (1%) Frame = -3 Query: 943 GGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXG-GXXGGXGXXXXGXXXXGGXXX 767 G G G GGG G GGG G GG GG G G GG G G G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Query: 766 XGXXGGXXXGXRGXXG 719 G G G RG G Sbjct: 64 WGRMQGGGMG-RGPGG 78 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXG-GGGXGGXXGGGXG---XGGXGGGGGXG 819 G G G G G G G G G GGG G GGG G GG G G G G Sbjct: 55 GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQG 103 Score = 37.5 bits (83), Expect = 0.016 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGG-GXGGXXGGXXGXXXGGXG-GXXGGXGXXXXGXXXXGGX 773 G GG G GGG G GGG G G GG GG G G GG G G Sbjct: 35 GPGGGWGRGSGGGWGRMQGGGMGR-GPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQE 93 Query: 772 XXXGXXGGXXXGXRG 728 G G G RG Sbjct: 94 GGMGRGPGQGWGCRG 108 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 3/73 (4%) Frame = -1 Query: 954 GXXGGGGXXXGGXXGXXXGXGGGGGXGXXXGG---XXXGXXGGXGGXXXXXXXGXGGXXX 784 G GGG G G GGG G G G G G GG G G Sbjct: 33 GRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQ 92 Query: 783 XGGXGXXGXXGGG 745 GG G G G Sbjct: 93 EGGMGRGPGQGWG 105 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 7/83 (8%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXX---PXPPXXPPXPPXXXPXXPPXXPPXP-- 884 P PR P P PP P P PP PP P PP PP P Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPP-PPFGPPPPFY 494 Query: 885 --PPPPXXPXPPPXPXXXXPPPP 947 PPPP PPP PP Sbjct: 495 RGPPPPRGMPPPPRQRMPSQGPP 517 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 7/57 (12%) Frame = +1 Query: 796 PXSXXPXXPXPPP-----PPXPPXPXPPPXXPPXPP--PPXPXPXPXXXPXXXPPPP 945 P P P PP PP P PPP P PP PP P P PPPP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 2/74 (2%) Frame = +1 Query: 730 PXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPP--PPPXPPXPXPPPXXPPXPPPPXPX 903 P P P PP P P PP PP PP P PP P P Sbjct: 421 PAANMRLPPPPQHTGPPQPR--PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPP 478 Query: 904 PXPXXXPXXXPPPP 945 P P PPPP Sbjct: 479 PRGFPPPPFGPPPP 492 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 PP P P P PPPP P PP PP P P P Sbjct: 471 PPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGP 516 Score = 36.7 bits (81), Expect = 0.028 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +1 Query: 712 LSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXP--PPPPXPPXPXPPPXXPPXP 885 LSTP P P P P P PPPP PPP P Sbjct: 418 LSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYP 477 Query: 886 PPP--XPXPXPXXXPXXXPPPPP 948 PP P P P PPPP Sbjct: 478 PPRGFPPPPFGPPPPFYRGPPPP 500 Score = 35.9 bits (79), Expect = 0.048 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPP---PPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 PP P PPP PP P P PP P PP P P P PP Sbjct: 460 PPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQV 519 Query: 946 PXP 954 P Sbjct: 520 HYP 522 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +1 Query: 721 PXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPP--XXPPXPPPP 894 P P P P PP P P P PP P PPP P PP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQ 518 Query: 895 XPXP 906 P Sbjct: 519 VHYP 522 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWL 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWL 323 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWL 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWL 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWL 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG-GXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXG 777 G G GGG G G G G GGG G G G G GG G G G G G G Sbjct: 261 GQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPG 320 Query: 776 G 774 G Sbjct: 321 G 321 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 1/77 (1%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXG-GXXGGXGXXXXGXXXXGGXX 770 G GG G GGG G GGG G GG G GG G G GG G GG Sbjct: 279 GPGGGWGRGSGGGWGRM-QGGGMGRGPGGGWGRMQGGMGRGPGGGWG------RMQGGGM 331 Query: 769 XXGXXGGXXXGXRGXXG 719 G GG G G G Sbjct: 332 GRGPGGGLGRGPGGGWG 348 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG---GXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXX 783 G G GGG G G G GGG G GG G G G G GGG G G Sbjct: 277 GRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMG-RGP 335 Query: 782 XGGXXXXXGXGXXXXXXGXXG 720 GG G G G G Sbjct: 336 GGGLGRGPGGGWGRMQGGGMG 356 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G GGG G G G G G G G GGG G G GGG G G G G Sbjct: 253 GRGSGGGWGQGPGGGWGRGQGRG-MGRGPGGGWGR-GSGGGWGRMQGGGMGRGPGGGWGR 310 Query: 773 XXXXXGXG 750 G G Sbjct: 311 MQGGMGRG 318 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXG-GGGXGGXXGGGXG---XGGXGGGGGXG 819 G G G G G G G G G GGG G GGG G GG G G G G Sbjct: 314 GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQG 362 Score = 35.9 bits (79), Expect = 0.048 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGG---GXGGXXGGGXGXG-GXGGGGGXGXXG 810 G G GGG G G G GGG G GG G G G G G G G G G Sbjct: 316 GRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRG 367 Score = 35.1 bits (77), Expect = 0.084 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G G GGG G G G GGG G G G G G G G G G Sbjct: 332 GRGPGGGLGRGPGGGWGR-MQGGGMGRGPGQGWGCRGMGCGWGCG 375 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXGG--XGGXXGGXGXXXXGXXXXG-GXXXXGXXG 752 G GGG G G GGG G G G GG G GG G G G G G Sbjct: 255 GSGGGWGQ-GPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG 313 Query: 751 GXXXGXRGXXG 719 G G G G Sbjct: 314 GMGRGPGGGWG 324 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 940 GGXXXXGXGGGXGXXGGGGGXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGG 776 GG G GGG G G GGG G GG G G G G G GG Sbjct: 328 GGGMGRGPGGGLGR-GPGGGWGRMQGGGMGRGPGQGWGCRGMGCGWGCGNGRFGG 381 Score = 33.5 bits (73), Expect = 0.26 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 953 GXGGGGGXXXGXXXGXGXGXGGGGXGGXXGGGXGXGGXGGGGGXGXXGXXXXGXXXXXGG 774 G G G G G G G G G G GGG G G GGG G G G GG Sbjct: 231 GIGRGSG---SPMWGGGMGQGPRGWGRGSGGGWGQ-GPGGGWGRGQGRGMGRG---PGGG 283 Query: 773 XXXXXGXGXXXXXXGXXG 720 G G G G Sbjct: 284 WGRGSGGGWGRMQGGGMG 301 Score = 31.9 bits (69), Expect = 0.79 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -3 Query: 946 GGGGXXXXGXGGGXGXXGGGG-GXGGXXGGXXGXXXGGXGGXXGGXGXXXXGXXXXGGXX 770 G GG GGG G GGG G G GG G GG G G G G G Sbjct: 318 GPGGGWGRMQGGGMGRGPGGGLGRG--PGGGWGRMQGGGMGRGPGQGWGCRG-MGCGWGC 374 Query: 769 XXGXXGG 749 G GG Sbjct: 375 GNGRFGG 381 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -2 Query: 911 GXGXGXGGGG---XGGXXGGGXGXG-GXGGGGGXGXXGXXXXGXXXXXG-GXXXXXGXG 750 G G G G G GG G G G G GGG G G G G G G G G Sbjct: 229 GPGIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRG 287 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWL 278 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWL 420 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPP--PPXPXPXPXXXPXXXPPP--PPXP 954 P PPPP P P PP P PP P P P P P P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPP 944 P P P P PP P P PPPPP P P P PP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 810 PXPPXXPPXP--PXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 P PP P P P P PP P PPPPP P P PP Sbjct: 780 PPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 826 PPPPPXPPXPXPPPXXPPXPP-PPXPXPXPXXXPXXXPPPPPXP 954 PPPPP P P P P P PP P P P P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 811 PXXPXPPPPPXPP-----XPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P PP P P P PP P PPPP P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 777 PPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXP 923 PP PP P PP P PP PP P P P PP P Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARP-TPPPPPPGKPTKPTKPSLPPVP 826 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXPPPP 947 PP PP P PP P PP P PPP P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 PP P P PP P P PPP P P P P P Sbjct: 781 PPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 750 PPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPP 914 PP P P P PP P PP PP P P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP----PPGKPTKPTKPSLPPVPP 827 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWL 275 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWL 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWL 638 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWL 394 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWL 237 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWL 195 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWL 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWL 206 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWL 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWL 90 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWL 627 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWL 123 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWL 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWL 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWL 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/113 (27%), Positives = 37/113 (32%), Gaps = 7/113 (6%) Frame = +1 Query: 637 PXXLPRALSCSXLPXRXLSXSLXAGLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPX 816 P +P L +P + A ++ P P + PP P P Sbjct: 331 PKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMR-PPGAGNGPGGPPPP 389 Query: 817 XPXP------PPPPXPPXPXPPPXXPPXPPPPXPXPXPXXX-PXXXPPPPPXP 954 P PPPP PP P PP P P P P PPPPP P Sbjct: 390 WSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXP-PXPPPPXPXPXPXXXPXXXPPPPPX 951 PP P P P P PP P PP P PP P P P PPP Sbjct: 386 PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDA 445 Query: 952 P 954 P Sbjct: 446 P 446 Score = 38.7 bits (86), Expect = 0.007 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 9/79 (11%) Frame = +3 Query: 732 RXPXXXPPXXPXXXX--PPXXXXPXXXXPXPPXXPPXPPXXX--PXXPPXXPPX---PPP 890 R P PP PP P P PP PP PP P PP PPP Sbjct: 370 RPPGMRPPGAGNGPGGPPPPWSKPGGILPGPP--PPGPPMLNMAPSIPPWQTTPGYIPPP 427 Query: 891 PPXXPX--PPPXPXXXXPP 941 PP P PPP P P Sbjct: 428 PPGFPQFQPPPPPPPSDAP 446 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 838 PXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPP 945 P PP P P PPP P P P PPPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPP 342 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 816 PPXXPPXPPXXXPXXPPXXPPXPPPP-PXXPXPPPXPXXXXPPPP 947 PP P P PP P PP P PPP P PPP Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +2 Query: 770 PXPPXXXXPPXPXXXXXXXPPXP-PXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P PP PP P PP P P PP P P PP PP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPP 377 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +1 Query: 826 PPPP----PXPPXPXPPPXXPPXPPPPXPXP-XPXXXPXXXPPPPP 948 PPPP P P PPP P PP P P P PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 796 PXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P + P P PPP P P PPPP P P P P Sbjct: 310 PAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 775 PPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPP 942 PP P + P P P P PP P PP P P P P P Sbjct: 308 PPPAASEPAAFAPAPP-PSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 794 PPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPPP 943 PP P P P P P P PPPP P P PP P Sbjct: 400 PPPPGPPMLNMAPSIP--PWQTTPGYIP-PPPPGFPQFQPPPPPPPSDAP 446 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 8/84 (9%) Frame = +3 Query: 720 PXXPRXPXXXPPXXPXXXXPPXXXXPXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPP-- 893 P P PP PP P P P P PP PP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGA 379 Query: 894 ---PXXPXPP---PXPXXXXPPPP 947 P P PP P PPPP Sbjct: 380 GNGPGGPPPPWSKPGGILPGPPPP 403 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWL 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWL 264 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWL 655 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWL 377 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWL 881 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWL 266 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/48 (45%), Positives = 29/48 (60%) Frame = +2 Query: 209 FVTIISCNKQVNXXXCIHFMFQVQGXVWEVFSALMNRPTRGERRFAYW 352 F+++I V+ I+ + V V +ALMNRPTRGERRFAYW Sbjct: 158 FLSLIPKTNNVSLIEAINTTLPIGKPV--VPAALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWL 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWL 566 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWL 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWL 1011 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWL 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWL 516 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWL 312 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWL 131 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWL 101 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWL 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWL 306 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWL 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWL 152 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWL 1022 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P PPPPP PP P PP P P P P P P PP P Sbjct: 1660 PAPPPPP-PPAPGPP---GPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 36.7 bits (81), Expect = 0.028 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 9/62 (14%) Frame = +1 Query: 796 PXSXXPXXPXPPPP-PXPPXPXPP--------PXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P P P PPPP P PP P P P P PP P P P P P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAG 1714 Query: 949 XP 954 P Sbjct: 1715 PP 1716 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 4/68 (5%) Frame = +1 Query: 709 GLSTPXXPXXXXXXPXPXXLXXPPXXXXXPXSXXPXXPXPPP----PPXPPXPXPPPXXP 876 GL+ P P P P PP + P P PP PP PP P P P Sbjct: 1786 GLAGPQGPKGMPGPPGPPG---PPGAIGWKGN--PGNPAGPPGLDGPPGPPGPQGPKGWP 1840 Query: 877 PXPPPPXP 900 P PP P Sbjct: 1841 GVPGPPGP 1848 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P PPP P P P P P P PP P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGP 1696 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 761 PXXPXPPXXXXPPXPXXXXXXXPPXPPXXPXXXPPXXXPXPPPPPXPXXXPXXPPXXXPP 940 P P PP PP P P P P P PP P P P P P Sbjct: 1660 PAPPPPP----PPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Query: 941 P 943 P Sbjct: 1716 P 1716 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXPXXXXP 938 P P PP PP P P P P P PP P P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 10/53 (18%) Frame = +1 Query: 820 PXPPPPPXPP----------XPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPP 948 P PP PP PP P PP P PP P PP PP Sbjct: 1797 PGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 6/71 (8%) Frame = +1 Query: 751 PXPXXLXXPP---XXXXXPXSXXPXXP-XPPPPPXPPXPXPPPXXP--PXPPPPXPXPXP 912 P P PP P P P PP PP P P P P P PP P Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPMG 1723 Query: 913 XXXPXXXPPPP 945 P PP Sbjct: 1724 PPGPSGGQGPP 1734 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWL 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWL 502 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWL 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWL 550 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWL 548 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 810 PXPPXXPPXPPXXXPXXPPXXPPXP----PPPPXXPXPPPXPXXXXPPPP 947 P P PP P P P PP P P P PP P P PP Sbjct: 152 PEPETVPPQPETVPPQ-PETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPP 200 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +1 Query: 751 PXPXXLXXPPXXXXXPXSXXPXXPXPPPPPXPPXPXPPPXXPPXPPPPXPXPXP 912 P P P P + P PP P P P P P P P P Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEP 199 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +1 Query: 811 PXXPXPPPPPXP-PXPXPPPXXPPXPPPPXPXP-XPXXXPXXXPPPPPXP 954 P P P P P P P PP P P P P P PP P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 795 PXXXXPXPPXXPPXPPXXXPXXPPXXPPXPPPPPXXPXPPPXP 923 P P P PP P P P P PP P PP P Sbjct: 161 PETVPPQPETVPPQPGSEEPE-PVSQAPEPPKPKTSAPEPPKP 202 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 820 PXPPPPPXPPXPXPPPXXPPXPPPPXPXPXPXXXPXXXPPPPPXP 954 P P P P PP P P P P P P PP P Sbjct: 159 PQPETVPPQPETVPPQPGSEEPEPVSQAPEP-PKPKTSAPEPPKP 202 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWL 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWL 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWL 318 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWL 1233 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWL 134 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWL 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWL 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWL 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWL 1503 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWL 656 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWL 116 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWL 353 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWL 201 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 269 FQVQGXVWEVFSALMNRPTRGERRFAYW 352 FQV V V +ALMNRPTRGERRFAYW Sbjct: 113 FQVGKPV--VPAALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWL 565 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWL 118 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWL 187 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWL 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWL 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 340 VCVLGALPLPRSLTRCARSFGCGERYXL 423 +C G +PLPRSLTR ARSF CGER L Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWL 209 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 302 SALMNRPTRGERRFAYW 352 +ALMNRPTRGERRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 922 GXGGGXGXXGGGGGXGGXXGGXXGXXXG 839 G GGG G GGGGG GG G G G Sbjct: 84 GDGGGGGD-GGGGGDGGGDGDGDGDGDG 110 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 899 GXGGGGXGGXXGGGXGXGGXGGGGGXG 819 G GGGG G GGG G GG G G G G Sbjct: 84 GDGGGG-GDGGGGGDG-GGDGDGDGDG 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,874,161 Number of Sequences: 59808 Number of extensions: 606534 Number of successful extensions: 32504 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11304 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2800542235 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -