BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B18 (970 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0415 - 17395988-17396161,17397349-17397444,17397489-173980... 29 5.6 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 7.4 11_04_0158 + 14207463-14207629,14207724-14207774,14207874-142080... 28 9.7 07_01_0479 + 3606663-3607448 28 9.7 >11_04_0415 - 17395988-17396161,17397349-17397444,17397489-17398026, 17398106-17398422 Length = 374 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 637 PRGGF*XXKXIFGGXQXRGXPPGXGXGGXXPGGKXXPXGXXXFXPGGFSXXK 482 PRGG FGG G P G G GG G P G P GF K Sbjct: 8 PRGGGGGGPRGFGG----GGPRGFGGGGPRGFGGGGPRGFGGGGPRGFGGSK 55 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 429 PPXGXXPXXPRXXFXXGXXXXENPPGXKXXXPXGXFXPPGXXPPXPXPGGXP 584 PP G P P G + P P G P PP P PG P Sbjct: 13 PPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPP 64 >11_04_0158 + 14207463-14207629,14207724-14207774,14207874-14208002, 14209342-14209447,14209491-14209601,14210042-14210098, 14210903-14211727 Length = 481 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 522 PXGXFXPPGXXPPXPXPGGXPLFXXPPKXF 611 P F PG PP PG PLF P F Sbjct: 259 PPQLFNWPGHAPPQLPPGASPLFPPGPAAF 288 >07_01_0479 + 3606663-3607448 Length = 261 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 429 PPXGXXPXXPRXXFXXGXXXXENPPGXKXXXPXGXFXPPGXXPPXPXPGGXP 584 PP G P R + PPG P G PPG P P G P Sbjct: 169 PPPGQMPPPMRPPQMP--IPFQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPP 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,399,532 Number of Sequences: 37544 Number of extensions: 341744 Number of successful extensions: 793 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2811537600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -