BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B17 (974 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.19 SPBC577.15c |||NASP family histone binding protein|Schizosacchar... 29 0.99 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 28 1.7 SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyce... 27 3.0 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 26 7.0 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.5 bits (68), Expect = 0.19 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 275 AIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAP 168 AIA P +I+P ++RP S+F+KS A + +P Sbjct: 202 AIADPNIISPIDSVRPLLSLFIKSITSAISALILSP 237 >SPBC577.15c |||NASP family histone binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 29.1 bits (62), Expect = 0.99 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 392 LNSLKLEIHNYLQSCFKLNASLEFNDKVY 306 L L LEI N+ Q+ L +LE+ +KVY Sbjct: 205 LGELSLEIENFSQASQDLKTALEWKEKVY 233 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 28.3 bits (60), Expect = 1.7 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 212 LKSFH-LGSGAALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPIQYRSTRTLRMIKS 36 L+S H L S + T PR N + K + P ++ F+I + Y TR L I++ Sbjct: 291 LQSVHYLISTISATLPRTLYNIVLFMVAAAKTVAPSVFATFAFRISVMYAVTRILPAIQN 350 >SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 27.5 bits (58), Expect = 3.0 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = -1 Query: 377 LEIHNYLQSCFKLNASLEFNDKVYFPNDFACPMTAIAGPALINPSRTLRPTFSI 216 L +H YL +C + + +E ++ + +T+I P +++PS+ + S+ Sbjct: 130 LLLHLYLLNCHEQGSLIEEPRPLFLDPSWKEKVTSIMSPQMVDPSKMISSCLSL 183 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 26.2 bits (55), Expect = 7.0 Identities = 17/73 (23%), Positives = 19/73 (26%) Frame = +3 Query: 651 PPPPXXXXXXXXKXXPXAGPPPXGGGXXXPXXXKXXXRXXRXPXPPQXPXXXXPXXGKXX 830 PP P A PP P K P P + P P G Sbjct: 1150 PPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPP 1209 Query: 831 XPXXSXSPXPXXP 869 P S +P P Sbjct: 1210 VPPPSTAPPVPTP 1222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,678,179 Number of Sequences: 5004 Number of extensions: 43145 Number of successful extensions: 102 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 501293686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -