BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B13 (957 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 40 7e-04 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 37 0.005 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 34 0.034 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 34 0.034 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 33 0.079 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 32 0.10 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 32 0.14 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 31 0.24 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 28 1.7 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 28 2.2 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 28 2.2 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 28 2.2 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 3.0 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 39.5 bits (88), Expect = 7e-04 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P P P P P P P G P P PP GP PPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPP--PPPGVAGAGPPPPPPPPPAVSAGG 789 Query: 853 XRXXXSXPPPPXRP 894 R P P Sbjct: 790 SRYYAPAPQAEPEP 803 Score = 35.1 bits (77), Expect = 0.015 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +3 Query: 660 LIXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPA 833 L+ P PP+ P P P P PPP P G PP P A PPA Sbjct: 728 LLKSPPPPPPAVIVPTPAPAPIPV-PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPA 784 Score = 33.5 bits (73), Expect = 0.045 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 660 LIXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPA 833 +I TP P PP P PPPPP PP P S PA Sbjct: 739 VIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPA 796 Score = 27.9 bits (59), Expect = 2.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 739 PXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPPPXRPXFS 903 P PP P P P PPPP P PPPP P S Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPG-VAGAGPPPPPPPPPAVS 786 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 36.7 bits (81), Expect = 0.005 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 851 GEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGGGXPXGGRGXGG 672 GEG GG G GP EGG G G P G G G G G GG G G Sbjct: 215 GEGHHHGGHGGFGGGPGGF--EGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGPG 272 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 33.9 bits (74), Expect = 0.034 Identities = 21/77 (27%), Positives = 23/77 (29%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PP P G P P PPS P P P+ Sbjct: 415 PPVPTPP-SLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAA 473 Query: 853 XRXXXSXPPPPXRPXFS 903 + P P P S Sbjct: 474 PAPPPAPAPAPAAPVAS 490 Score = 30.7 bits (66), Expect = 0.32 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 2/72 (2%) Frame = +1 Query: 685 LPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPP--PXXXPSPXR 858 LPP G P P P P P P P PP P P P Sbjct: 403 LPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAG 462 Query: 859 XXXSXPPPPXRP 894 + P PP P Sbjct: 463 MPAAPPLPPAAP 474 Score = 29.9 bits (64), Expect = 0.55 Identities = 22/84 (26%), Positives = 25/84 (29%), Gaps = 6/84 (7%) Frame = +1 Query: 658 DSXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPX 837 +S PP P PP P PP PP PPPP Sbjct: 285 NSTSKPPLP-PPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPP 343 Query: 838 XX------PSPXRXXXSXPPPPXR 891 P P + + PPPP R Sbjct: 344 RSNAAGSIPLPPQGRSAPPPPPPR 367 Score = 29.9 bits (64), Expect = 0.55 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +1 Query: 673 PPXPLPPXGX-PPPXXXPXXXXXPXPPXXGKPXX--PXFPPSXQXXXGPXXXXPPPPXXX 843 PP P G PPP P P P P PP P PP Sbjct: 365 PPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLP 424 Query: 844 PS-PXRXXXSXPP 879 PS P S PP Sbjct: 425 PSAPPSLPPSAPP 437 Score = 28.3 bits (60), Expect = 1.7 Identities = 20/77 (25%), Positives = 22/77 (28%), Gaps = 3/77 (3%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXP-PPPXXXPS 849 PP +P P P P P P P S P PPP S Sbjct: 241 PPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVS 300 Query: 850 PXRXXXS--XPPPPXRP 894 + PPPP P Sbjct: 301 AAALAANKKRPPPPPPP 317 Score = 27.9 bits (59), Expect = 2.2 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 674 PPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXP 847 P PSLP PP P P A P P P+ PP P P Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAA-PPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Score = 27.5 bits (58), Expect = 3.0 Identities = 15/58 (25%), Positives = 19/58 (32%) Frame = +3 Query: 720 PPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPGPXXXXPPTXXA 893 PP PP P PP +P + PP+ + P P PP A Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPA 472 Score = 27.1 bits (57), Expect = 3.9 Identities = 18/74 (24%), Positives = 18/74 (24%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P P P P P P P PP PP P S Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPA 283 Query: 862 XXSXPPPPXRPXFS 903 S PP P S Sbjct: 284 INSTSKPPLPPPSS 297 Score = 27.1 bits (57), Expect = 3.9 Identities = 20/76 (26%), Positives = 27/76 (35%), Gaps = 4/76 (5%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPP---- 830 I P+ + PPP P PPP + P +P A G + PP Sbjct: 351 IPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPA-IPGRSAPALPPLGNA 409 Query: 831 ARXGSLPXPGPXXXXP 878 +R + P P P P Sbjct: 410 SRTSTPPVPTPPSLPP 425 Score = 27.1 bits (57), Expect = 3.9 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXG 842 P PPS PP P P PP PP +P A S P + G Sbjct: 447 PPLPPSAPIAPPL---PAGMPAAPPLPPAAPAPPPAPAPAPAAPVASIAELPQQDG 499 Score = 26.2 bits (55), Expect = 6.8 Identities = 21/73 (28%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPP--------PPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARX 839 PP PPP PP P P G++ PP P A + G +R Sbjct: 325 PPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRA 384 Query: 840 GSLPXPGPXXXXP 878 S P P P P Sbjct: 385 VSNP-PAPPPAIP 396 Score = 26.2 bits (55), Expect = 6.8 Identities = 19/74 (25%), Positives = 20/74 (27%), Gaps = 5/74 (6%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXG-----AXSXXXPPAR 836 TP P PP P PP G PP P + PPA Sbjct: 414 TPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAA 473 Query: 837 XGSLPXPGPXXXXP 878 P P P P Sbjct: 474 PAPPPAPAPAPAAP 487 Score = 25.8 bits (54), Expect = 9.0 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 3/72 (4%) Frame = +1 Query: 673 PPXPLPPXGXPP---PXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXX 843 PP P PP P P PP P PP PPP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAI- 395 Query: 844 PSPXRXXXSXPP 879 P R + PP Sbjct: 396 --PGRSAPALPP 405 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 33.9 bits (74), Expect = 0.034 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P+PP PP P P PP P P PS P PP PS Sbjct: 1190 PVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP--TPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Query: 862 XXSXP 876 S P Sbjct: 1248 SVSTP 1252 Score = 31.9 bits (69), Expect = 0.14 Identities = 20/74 (27%), Positives = 23/74 (31%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P P PP P P P G P P + P P P +P Sbjct: 1092 PPVPKPSVAAPP-VPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAP 1150 Query: 853 XRXXXSXPPPPXRP 894 S PP +P Sbjct: 1151 PVPAPSGAPPVPKP 1164 Score = 31.1 bits (67), Expect = 0.24 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXP-PPPX 837 S PP P P PP P P P G P P + P P P P Sbjct: 1108 SVAVPPVPAP--SGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPS 1165 Query: 838 XXPSPXRXXXSXPPPPXRP 894 P S PP +P Sbjct: 1166 VAAPPVPAPSSGIPPVPKP 1184 Score = 31.1 bits (67), Expect = 0.24 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXX 840 S PP P P G PP P P PP P P PS P PP Sbjct: 1165 SVAAPPVPAPSSGIPP-VPKPAAGVPPVPPPSEAPPVP--KPSVGVPPVPPPSTAPP--- 1218 Query: 841 XPSPXRXXXSXPPP 882 P+P P P Sbjct: 1219 VPTPSAGLPPVPVP 1232 Score = 29.9 bits (64), Expect = 0.55 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPP-PPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSL- 848 P P PP P PP P P G PP P A S PP S Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPP--PSEAPPVPKPSVGVPPVPPPSTA 1216 Query: 849 -PXPGPXXXXPP 881 P P P PP Sbjct: 1217 PPVPTPSAGLPP 1228 Score = 29.1 bits (62), Expect = 0.97 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 3/73 (4%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPX--PPXXGKPXXPXFPPSXQXXXGPXXXXPP-PPXXXP 846 P P P PPP P PP P P P P PP P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSK 1020 Query: 847 SPXRXXXSXPPPP 885 +P S PP Sbjct: 1021 APPVPLPSADAPP 1033 Score = 29.1 bits (62), Expect = 0.97 Identities = 25/88 (28%), Positives = 27/88 (30%), Gaps = 10/88 (11%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPX----FPPSXQXXXG------P 810 S PP P+P PP P P P G P P PP G P Sbjct: 1127 SVAAPPVPVPSGA--PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Query: 811 XXXXPPPPXXXPSPXRXXXSXPPPPXRP 894 PP P +P S PP P Sbjct: 1185 AAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 Score = 28.3 bits (60), Expect = 1.7 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPA---RXGS 845 P PS PP P P PP P P +P A S PP G Sbjct: 1122 PVPKPSVAAPP---VPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGI 1178 Query: 846 LPXPGPXXXXPP 881 P P P PP Sbjct: 1179 PPVPKPAAGVPP 1190 Score = 28.3 bits (60), Expect = 1.7 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXP-PXXGKPXXPXFPPSXQXXXGPXXXXPPPPX 837 S PP P P G PP P P P P G P P P + P PP Sbjct: 1146 SVAAPPVPAPS-GAPP-VPKPSVAAPPVPAPSSGIPPVPK-PAAGVPPVPPPSEAPP--- 1199 Query: 838 XXPSPXRXXXSXPPPPXRP 894 P P PPP P Sbjct: 1200 -VPKPSVGVPPVPPPSTAP 1217 Score = 27.9 bits (59), Expect = 2.2 Identities = 20/74 (27%), Positives = 21/74 (28%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP P P P P P P S P P P+P Sbjct: 1012 PPVP-KLSSKAPPVPLPSADAPPIPVPSTAPPVP-IPTSTPPVPKSSSGAPSAPPPVPAP 1069 Query: 853 XRXXXSXPPPPXRP 894 S P P P Sbjct: 1070 SSEIPSIPAPSGAP 1083 Score = 27.5 bits (58), Expect = 3.0 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 6/79 (7%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXP----PPPPXXGQTXXPPFSPLXAXTXGAXSXXXPP 830 I P + P P PP P PP P P +P A S PP Sbjct: 1073 IPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPP 1132 Query: 831 ARX--GSLPXPGPXXXXPP 881 G+ P P P PP Sbjct: 1133 VPVPSGAPPVPKPSVAAPP 1151 Score = 27.5 bits (58), Expect = 3.0 Identities = 18/70 (25%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPP-PPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 P P PP P PP PPP P + + + P G P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Query: 852 XPGPXXXXPP 881 P P PP Sbjct: 1229 VPVPTAKAPP 1238 Score = 26.6 bits (56), Expect = 5.2 Identities = 17/70 (24%), Positives = 20/70 (28%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P P+P P P P G P P + P PP P +P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 856 RXXXSXPPPP 885 S PP Sbjct: 1123 VPKPSVAAPP 1132 Score = 26.6 bits (56), Expect = 5.2 Identities = 15/57 (26%), Positives = 16/57 (28%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P+PP PP P P P K P S P P SP Sbjct: 1209 PVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNASP 1265 Score = 26.2 bits (55), Expect = 6.8 Identities = 19/75 (25%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFP-PSXQXXXGPXXXXPP---PPXX 840 PP P+P P P P P P P PS PP P Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVA 1100 Query: 841 XPSPXRXXXSXPPPP 885 P + + PP P Sbjct: 1101 APPVPKPSVAVPPVP 1115 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 32.7 bits (71), Expect = 0.079 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXG 758 P PP PPP PP PPPPP G Sbjct: 6 PGNPPPP--PPPPGFEPPSQPPPPPPPG 31 Score = 31.9 bits (69), Expect = 0.14 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPP 749 P P PPP PP PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 808 PXXXXPPPPXXXPSPXRXXXSXPPPPXRPXF 900 P PPPP P P S PPPP P + Sbjct: 5 PPGNPPPPP---PPPGFEPPSQPPPPPPPGY 32 Score = 26.2 bits (55), Expect = 6.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 705 PPXXXPPPXXPPPPPXXGQTXXPPFSP 785 PP PPP PPPP + PP P Sbjct: 5 PPGNPPPP--PPPPGFEPPSQPPPPPP 29 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 32.3 bits (70), Expect = 0.10 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPP--PPPXXGQTXXP 773 TP PP PPP P P PP PPP + P Sbjct: 1706 TPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 31.9 bits (69), Expect = 0.14 Identities = 19/63 (30%), Positives = 22/63 (34%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 TP P PP P P PPP P P+ A A P + S+P Sbjct: 1689 TPPVRPQSAAPPQMSAPTP----PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Query: 852 XPG 860 PG Sbjct: 1745 NPG 1747 Score = 27.1 bits (57), Expect = 3.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 808 PXXXXPPPPXXXPSPXRXXXSXPPPP 885 P PPPP P P S PPPP Sbjct: 1710 PPMSVPPPPSAPPMPA-GPPSAPPPP 1734 Score = 26.2 bits (55), Expect = 6.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 826 PPPXXXPSPXRXXXSXPPPPXRP 894 PP P+P S PPPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAP 1721 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.9 bits (69), Expect = 0.14 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 6/73 (8%) Frame = +3 Query: 684 PPSXXXP----PPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSL- 848 PPS P P PPP PPPP Q + A S PP Sbjct: 173 PPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQA 232 Query: 849 -PXPGPXXXXPPT 884 P P P PPT Sbjct: 233 DPLPAPPPPPPPT 245 Score = 28.7 bits (61), Expect = 1.3 Identities = 18/67 (26%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPP---PPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXG 842 +P PP+ P P PPP PP T P G+ PP Sbjct: 220 SPEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATP 279 Query: 843 SLPXPGP 863 S P P Sbjct: 280 SQPPRPP 286 Score = 26.2 bits (55), Expect = 6.8 Identities = 19/72 (26%), Positives = 22/72 (30%), Gaps = 4/72 (5%) Frame = +1 Query: 688 PPXGXPPPXXXPXXXXXPXPPXX---GKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXR 858 PP PPP P G+ P PP+ PPPP P + Sbjct: 190 PPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPPTLPPQ 249 Query: 859 -XXXSXPPPPXR 891 S P P R Sbjct: 250 STNTSQLPMPSR 261 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.1 bits (67), Expect = 0.24 Identities = 20/75 (26%), Positives = 21/75 (28%), Gaps = 1/75 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P P P PP P P P P P P P P PS Sbjct: 128 PAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 853 XRXXXSXPP-PPXRP 894 + PP PP P Sbjct: 188 PSLPSAVPPMPPKVP 202 Score = 29.5 bits (63), Expect = 0.73 Identities = 17/65 (26%), Positives = 18/65 (27%), Gaps = 1/65 (1%) Frame = +1 Query: 703 PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPP-PXXXPSPXRXXXSXPP 879 PP P P P P PP P PP P P P + Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 880 PPXRP 894 PP P Sbjct: 184 PPSAP 188 Score = 28.7 bits (61), Expect = 1.3 Identities = 18/71 (25%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = +3 Query: 684 PPSXXXPPPXXXPP-PXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPG 860 PP+ P P PP P PP P P S P+ ++P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP 198 Query: 861 PXXXXPPTXXA 893 P PP A Sbjct: 199 PKVPPPPLSQA 209 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 787 RGEXGGXXVCPXKGGGGGXXGGGXXXGGGXXXEGGXRG 674 RG GG GG GG GG GG GG G Sbjct: 25 RGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSG 62 Score = 27.1 bits (57), Expect = 3.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 751 KGGGGGXXGGGXXXGGGXXXEGGXRG 674 +GG GG GG GG GG RG Sbjct: 8 RGGRGGSRGGRGGFNGGRGGFGGGRG 33 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 27.9 bits (59), Expect = 2.2 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +1 Query: 703 PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPP 882 PPP P PP +P PP P PPPP PPP Sbjct: 287 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE--PGEHMPPPPMH----HEPGEHMPPP 340 Query: 883 PXR 891 P + Sbjct: 341 PFK 343 Score = 27.5 bits (58), Expect = 3.0 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 703 PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPP 882 PPP P PP +P PP P PPPP PPP Sbjct: 209 PPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHE--PGEHMPPPPMH----HEPGEHMPPP 262 Query: 883 P 885 P Sbjct: 263 P 263 Score = 27.5 bits (58), Expect = 3.0 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 703 PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPP 882 PPP P PP +P PP P PPPP PPP Sbjct: 235 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE--PGEHMPPPPMH----HEPGEHMPPP 288 Query: 883 P 885 P Sbjct: 289 P 289 Score = 27.5 bits (58), Expect = 3.0 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 703 PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPP 882 PPP P PP +P PP P PPPP PPP Sbjct: 261 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE--PGEHMPPPPMH----HEPGEHMPPP 314 Query: 883 P 885 P Sbjct: 315 P 315 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 27.9 bits (59), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 787 RGEXGGXXVCPXKGGGGGXXGGGXXXGGGXXXEGGXRG 674 RG GG GG G GGG G GG RG Sbjct: 151 RGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRG 188 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.9 bits (59), Expect = 2.2 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 PLPP PP P PP G P P S P PP P+P Sbjct: 492 PLPPTTFAPPGV-------PLPPIPGAPGMPNLNMSQPPMVPPGMALPP---GMPAPFPG 541 Query: 862 XXSXPPPPXRP 894 + P P P Sbjct: 542 YPAVPAMPGIP 552 Score = 26.2 bits (55), Expect = 6.8 Identities = 16/54 (29%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXP--PPPPXXGQTXXPPFSPLXAXTXGAXSXXXPP 830 P PP PP P P P P P PP +P T + + PP Sbjct: 523 PMVPPGMALPPGMPAPFPGYPAVPAMPGIPGATAPPGAPGSYNTSESSNLNAPP 576 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPP 749 TP+ PP PP P P PPP Sbjct: 1051 TPQLPPVSSRLPPVSATRPQIPQPPP 1076 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPP 776 PP P PPPP G+T PP Sbjct: 908 PPPPPTASMTASAPAIASPPPPKVGETYHPP 938 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,548,701 Number of Sequences: 5004 Number of extensions: 43806 Number of successful extensions: 465 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 489310570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -