BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B13 (957 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 91 9e-19 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 74 1e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 68 1e-11 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 67 2e-11 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 54 2e-07 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 46 3e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 2e-04 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 44 2e-04 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 44 2e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 44 2e-04 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 42 6e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 41 0.001 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 41 0.002 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 41 0.002 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 41 0.002 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 41 0.002 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 41 0.002 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 41 0.002 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 41 0.002 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.002 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 41 0.002 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 0.002 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 41 0.002 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 41 0.002 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 41 0.002 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 41 0.002 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 41 0.002 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 41 0.002 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 41 0.002 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 41 0.002 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 41 0.002 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 41 0.002 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 41 0.002 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 41 0.002 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 41 0.002 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 41 0.002 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 41 0.002 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 41 0.002 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 41 0.002 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 41 0.002 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 41 0.002 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 41 0.002 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 41 0.002 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 41 0.002 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 41 0.002 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 41 0.002 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 41 0.002 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 41 0.002 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 41 0.002 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 41 0.002 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 41 0.002 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 41 0.002 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 41 0.002 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 41 0.002 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 41 0.002 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 41 0.002 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 41 0.002 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 41 0.002 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 41 0.002 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 41 0.002 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 41 0.002 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 41 0.002 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 41 0.002 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 41 0.002 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 41 0.002 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 41 0.002 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 41 0.002 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 41 0.002 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 41 0.002 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 41 0.002 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 41 0.002 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 41 0.002 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 41 0.002 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 41 0.002 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 41 0.002 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 41 0.002 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 41 0.002 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 41 0.002 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 41 0.002 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 41 0.002 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.002 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 41 0.002 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 41 0.002 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 41 0.002 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 41 0.002 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 41 0.002 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 41 0.002 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 41 0.002 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 41 0.002 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 41 0.002 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 41 0.002 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 41 0.002 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 41 0.002 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 41 0.002 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 41 0.002 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 41 0.002 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 41 0.002 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 41 0.002 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 41 0.002 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 41 0.002 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 41 0.002 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 41 0.002 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 762 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 808 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 4 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 50 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 27 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 73 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 409 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 455 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 558 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 604 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 26 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 72 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 96.7 bits (230), Expect = 2e-20 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = -3 Query: 586 AYGKXPATRPFYGSWPLAGLLXTXSFLRYPLILWITVLPPLSELIPL 446 AYGK PATRPFYGSWP AGLL T SFLRYPLILWITVLPPLSELIPL Sbjct: 4 AYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 50 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 91.5 bits (217), Expect = 9e-19 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +2 Query: 338 SXINESANARGEAVCVLGALPXPRSLTRCXRSFGCGERYQLTQRR 472 S INESANARGEAVCVLGALP PRSLTRC RSFGCGERYQLTQRR Sbjct: 99 SCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 91.5 bits (217), Expect = 9e-19 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +2 Query: 338 SXINESANARGEAVCVLGALPXPRSLTRCXRSFGCGERYQLTQRR 472 S INESANARGEAVCVLGALP PRSLTRC RSFGCGERYQLTQRR Sbjct: 463 SCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 82.6 bits (195), Expect = 4e-16 Identities = 38/46 (82%), Positives = 38/46 (82%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE*AD 453 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE D Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 95 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 61 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 80.6 bits (190), Expect = 2e-15 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H +PA SPDSVDNRITAFE Sbjct: 3 RSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 80.6 bits (190), Expect = 2e-15 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAF WPF H FPA SPDSVDNRITAF+ Sbjct: 19 RSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 79.8 bits (188), Expect = 3e-15 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 RSLWK ASNAAFLRFLAFGWPF H F A SPD VDNRITAFE Sbjct: 19 RSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 74.1 bits (174), Expect = 1e-13 Identities = 42/75 (56%), Positives = 42/75 (56%) Frame = -2 Query: 590 RSLWKXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE*ADTAXXXXXXXXXXXX 411 RSLWK ASNAAFLRFLAF WPF H PA SPDSVD ITAFE D A Sbjct: 3 RSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRESV 62 Query: 410 XXXXXXRPIRKPPLP 366 R IRK LP Sbjct: 63 SEEAEERSIRKQTLP 77 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.1 bits (169), Expect = 6e-13 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 578 KXASNAAFLRFLAFGWPFXHXXFPAXSPDSVDNRITAFE 462 K ASNAAFLRFLAF WPF H FPA SPDSVDNRITAFE Sbjct: 23 KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 488 QNQGIXQERXCXQKASQRPGTVKRPRCWXFSIGSA 592 +NQGI QER C QKAS+RPGTVKRPRCW FSIGSA Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSA 148 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 67.3 bits (157), Expect = 2e-11 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +2 Query: 491 NQGIXQERXCXQKASQRPGTVKRPRCWXFSIGSA 592 NQGI QER C QKAS+RPGTVKRPRCW FSIGSA Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSA 119 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PPP P P PP P P PP P PPPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Query: 853 XRXXXSXPP 879 PP Sbjct: 433 ALRLACAPP 441 Score = 52.8 bits (121), Expect = 4e-07 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P P PP PPP P P PP P P PP P PPPP P P Sbjct: 365 PPPPPPPPPPPPSPPP-----PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 856 RXXXSXPPPPXRP 894 PPPP P Sbjct: 420 PPPPPPPPPPPPP 432 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXX 840 S PP P PP PPP P P PP P P PP P PPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP-----PPPPPPPPPPP 418 Query: 841 XPSPXRXXXSXPPPPXR 891 P P PPP R Sbjct: 419 APPPPPPPPPPPPPALR 435 Score = 46.0 bits (104), Expect = 5e-05 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXX 840 S PP P PP PPP P P PP P P PP P PPPP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP--PP-------PPAPPPPPPPP 427 Query: 841 XPSPXRXXXSXPPPPXR 891 P P + PP R Sbjct: 428 PPPPPALRLACAPPRLR 444 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPP-PPXXGQTXXPPFSPLXAXTXGAXSXXXPPARX 839 I +P PP PPP PPP PPP PP Q PP P PP Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP--PPPPPPPPPPPPPPPPPPP 418 Query: 840 GSLPXPGPXXXXPP 881 P P P PP Sbjct: 419 APPPPPPPPPPPPP 432 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/76 (35%), Positives = 29/76 (38%), Gaps = 2/76 (2%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXG--KPXXPXFPPSXQXXXGPXXXXPPPPXXXP 846 PP P PP PPP P P PP P P +PP P P PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP--PP 152 Query: 847 SPXRXXXSXPPPPXRP 894 +P PPPP P Sbjct: 153 NPPYPPPLYPPPPNPP 168 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 4/78 (5%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXF---PPSXQXXXGPXXXXP-PPPXX 840 PP P PP PP P P PP P P PP+ P P PPP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 841 XPSPXRXXXSXPPPPXRP 894 P P PPPP P Sbjct: 185 PPYPPPPNPPYPPPPNAP 202 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/74 (33%), Positives = 27/74 (36%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PP P P PP P P PP+ P PPPP P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP--PPNAPNPPPPNPPYPPPPNAPNPP 221 Query: 853 XRXXXSXPPPPXRP 894 + P PP P Sbjct: 222 YPPPPNAPNPPYPP 235 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/74 (36%), Positives = 28/74 (37%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PPP P P PP P P PP P PPP P+P Sbjct: 149 PPPPNPPY--PPPLYPPPPN--PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Query: 853 XRXXXSXPPPPXRP 894 PPPP P Sbjct: 205 PPPNPPYPPPPNAP 218 Score = 48.8 bits (111), Expect = 6e-06 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PPP P P PP P P PP P PPP P P Sbjct: 154 PPYP-PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 853 XRXXXSXPPPPXRP 894 PP P P Sbjct: 213 PPPNAPNPPYPPPP 226 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/78 (32%), Positives = 27/78 (34%), Gaps = 4/78 (5%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXP----XFPPSXQXXXGPXXXXPPPPXX 840 PP P PP PP P P PP P P +PP P PPP Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Query: 841 XPSPXRXXXSXPPPPXRP 894 P+ PPPP P Sbjct: 169 PPNAPYPPPPYPPPPNPP 186 Score = 46.8 bits (106), Expect = 3e-05 Identities = 27/77 (35%), Positives = 29/77 (37%), Gaps = 3/77 (3%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXP-PXXGKPXXPXFPPSXQXXXGPXXXXP-PPPXXXP 846 PP P PP PP P P P P P +PPS P P PPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 847 SPXRXXXSXP-PPPXRP 894 P + P PPP P Sbjct: 164 PPNPPPPNAPYPPPPYP 180 Score = 46.0 bits (104), Expect = 5e-05 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 8/82 (9%) Frame = +1 Query: 673 PPXPLPPX-GXPPPXXXPXXXXXPXPPXXGKPXXP------XFPPSXQXXXGPXXXXPPP 831 PP P PP PPP P P PP P P PP+ P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 832 P-XXXPSPXRXXXSXPPPPXRP 894 P P P PPPP P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAP 173 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P P PP PP P P PP P P PP P PPPP P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP-------PNPPYPPPP-NAPYP 141 Query: 853 XRXXXSXPPPPXRP 894 PPPP P Sbjct: 142 PSPNAPYPPPPNPP 155 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXP-PXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPS 849 P P PP PP P P P P P P +PP P PP P P Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP----PPNPPYPPP 214 Query: 850 PXRXXXSXPPPPXRP 894 P PPPP P Sbjct: 215 PNAPNPPYPPPPNAP 229 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/73 (35%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPX--XXPSPX 855 P PP PPP P P PP P P PP+ P PPPP PSP Sbjct: 90 PNPPY--PPPPYPPYPPPPPYPPPPNPPYPP--PPNAPYPPPPNPPYPPPPNAPYPPSPN 145 Query: 856 RXXXSXPPPPXRP 894 P PP P Sbjct: 146 APYPPPPNPPYPP 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 4/78 (5%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP----XX 840 PP P P PP P P PP P P P P PPPP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 841 XPSPXRXXXSXPPPPXRP 894 P P PPPP P Sbjct: 177 PPYPPPPNPPYPPPPNPP 194 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P P PP PPP P P PP P P PP P P PP P P Sbjct: 170 PNAPYPPPPYPPPPNPPYPP-PPNPPYPPPPNAPN-PPPPNPPYPPPPNAPNPP--YPPP 225 Query: 853 XRXXXSXPPPPXRPXFS 903 PPP P F+ Sbjct: 226 PNAPNPPYPPPPNPQFA 242 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P P PP P P PP P P PP P PPPP P P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPP-PPNPPPPNAPYPPPPYPPPPNPPY--PPPP-NPPYP 196 Query: 853 XRXXXSXPPPPXRP 894 PPPP P Sbjct: 197 PPPNAPNPPPPNPP 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 675 PRXPPSXXXPP-PXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 P PP PP P PPP P PPP PP P PP + P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Query: 852 XPGP 863 P P Sbjct: 233 YPPP 236 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +1 Query: 697 GXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXP-PPPXXXPSPXRXXXSX 873 G PP P PP P P +PP P P PPP P P Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY 140 Query: 874 PPPPXRP 894 PP P P Sbjct: 141 PPSPNAP 147 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/68 (33%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXP-PPPPXXGQTXXPPF-SPLXAXTXGAXSXXXPPARXGSLPXP 857 PP+ P P PPP P PPPP PP+ P A + PP P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP-P 142 Query: 858 GPXXXXPP 881 P PP Sbjct: 143 SPNAPYPP 150 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/77 (29%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP P P PP P P +PP P PP P +P Sbjct: 84 PPTNFSPN---PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPY-PPPPNPPYPPPPNAP 139 Query: 853 XRXXXSXP-PPPXRPXF 900 + P PPP P + Sbjct: 140 YPPSPNAPYPPPPNPPY 156 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 671 YPPXPSLPXXTPPPXXPPXXXXXPXP--LXXANPXXPXFPPLRKXXWGXXXXXPPRPXGX 844 YPP P P PPP PP P P P P +PP + P P Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Query: 845 PP 850 PP Sbjct: 154 PP 155 Score = 35.9 bits (79), Expect = 0.049 Identities = 22/69 (31%), Positives = 24/69 (34%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P PP P P PPP P PPP PP +P + PP P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP---YPPSPNAPYPPPPNP---PY 156 Query: 855 PGPXXXXPP 881 P P PP Sbjct: 157 PPPLYPPPP 165 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXA 794 PP+ PPP P P PPPP PP +P A Sbjct: 206 PPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQFA 242 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/71 (33%), Positives = 26/71 (36%), Gaps = 5/71 (7%) Frame = +3 Query: 684 PPSXXXP-PPXXXPPPXXPPP----PPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSL 848 PP P PP PPP PPP PP PP +P A PP+ Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNA---PYPPSPNAPY 148 Query: 849 PXPGPXXXXPP 881 P P P PP Sbjct: 149 PPP-PNPPYPP 158 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 671 YPPXPSLPXXT---PPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXG 841 YPP P+ P PPP PP P P P +PP + P P Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Query: 842 XPP 850 PP Sbjct: 208 NPP 210 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 671 YPPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXPP 850 YPP P P PP PP P P NP P PP PP P P Sbjct: 174 YPPPPYPPPPNPP-YPPPPNPPYPPPPNAPNPPPPN-PPYPPPPNAPNPPYPPPPNAPNP 231 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 671 YPPXPSLPXXTP--PPXXPPXXXXXPXPLXXANPXXPXFPP 787 YPP P+ P P PP PP P N P +PP Sbjct: 195 YPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +2 Query: 671 YPPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXPP 850 YPP P+ P PP P P P P P P PP P PP Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 48.4 bits (110), Expect = 9e-06 Identities = 27/71 (38%), Positives = 29/71 (40%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P PP PP P P PP KP P PP+ GP PPPP P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP-PPT----NGP--PPPPPPTNGPPPPPP 399 Query: 862 XXSXPPPPXRP 894 + PPPP P Sbjct: 400 PTNGPPPPPPP 410 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/69 (36%), Positives = 27/69 (39%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP PP P P PP P P PP+ GP PPPP P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP-PPTN----GPPP--PPPPTNGPPP 406 Query: 853 XRXXXSXPP 879 + PP Sbjct: 407 PPPPTNGPP 415 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPA 833 TP PP PPP PP PPPPP PP P PP+ Sbjct: 364 TPPPPPPTNKPPPPP-PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPS 416 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXP 825 PP P PP PPP P P PP P P P + G P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P PP+ P P PPPPP T PP P T G PP G P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPP----TNKPP--PPPPPTNG--PPPPPPPTNGPPPP 397 Query: 855 PGPXXXXPP 881 P P PP Sbjct: 398 PPPTNGPPP 406 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/71 (32%), Positives = 26/71 (36%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 +P P + PPP P PPPP T PP P T G PP P Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPP-----TNGPP--PPPPPTNG---PPPPPPPTNGPP 405 Query: 852 XPGPXXXXPPT 884 P P PP+ Sbjct: 406 PPPPPTNGPPS 416 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 687 PSXXXPPPXXXPPPXXPPPPPXXGQTXXPP 776 PS PPP PP PP PP G+ P Sbjct: 72 PSTPAPPPPPPPPSSGPPLPPSNGKCGRKP 101 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 659 THXXYPPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPX 838 T+ PP P PPP PP P P P P PP PP P Sbjct: 361 TNNTPPPPPPT--NKPPPPPPPTNGPPPPPPPTNGPPPPP-PPTN------GPPPPPPPT 411 Query: 839 GXPPXXG 859 PP G Sbjct: 412 NGPPSEG 418 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P PP PPP PP PPPP Q PP P T A PP + P Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPA 1114 Query: 855 PGP 863 P P Sbjct: 1115 PRP 1117 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +3 Query: 684 PPSXXXPPPXXXP-PPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPG 860 PP PP P PP P PP PP P + A PP S P P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Query: 861 PXXXXP-PTXXA 893 P P PT A Sbjct: 1088 PRQPDPIPTNPA 1099 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 2/73 (2%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 PLPP P P P P P P PP Q P P PP P P Sbjct: 1040 PLPPPRKPSPP--PSAVPIPPPRKPSPPPSEPAPPPRQPPP-PSTSQPVPPPRQPDPIPT 1096 Query: 862 XXSXP--PPPXRP 894 + P PPP +P Sbjct: 1097 NPAHPTEPPPRQP 1109 Score = 32.3 bits (70), Expect = 0.60 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PP P PP P P PPS P PPP P P Sbjct: 1019 PPGPTEQP-VPPKRKASPPSAQPLPP----PRKPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 Query: 853 XRXXXSXPPPP 885 + PPPP Sbjct: 1074 RQ-----PPPP 1079 Score = 31.9 bits (69), Expect = 0.79 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +1 Query: 682 PLPPX--GXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P+PP PP P PP P P PS P P PP P P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPS------PPPSEPAPPPRQPPPP 1079 Query: 856 RXXXSXPPP 882 PPP Sbjct: 1080 STSQPVPPP 1088 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/69 (26%), Positives = 19/69 (27%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P P PP P P P P + P P PP PSP Sbjct: 991 PHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPP 1050 Query: 856 RXXXSXPPP 882 PPP Sbjct: 1051 PSAVPIPPP 1059 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/66 (25%), Positives = 20/66 (30%) Frame = +3 Query: 687 PSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPGPX 866 P P P P P P Q PP P + P+ S P P P Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Query: 867 XXXPPT 884 PP+ Sbjct: 1075 QPPPPS 1080 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 2/76 (2%) Frame = -2 Query: 893 GRXGGGG--XXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXG 720 GR GGGG R G G GGGG G GG G G G G G Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Query: 719 XXXGGGXPXGGRGXGG 672 GGG GG G GG Sbjct: 195 GYGGGGGGYGGSGYGG 210 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = -2 Query: 890 RXGGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGG--XGXXXXXGX 717 R GGGG R G G GGGG G GG G G GG G G Sbjct: 155 RGGGGGYRGRGRGGGGY--GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Query: 716 XXGGGXPXGGRGXGG 672 GGG GGR GG Sbjct: 213 GYGGGGYGGGRSGGG 227 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -2 Query: 893 GRXGGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXG-GXGXXXXXGX 717 G GGGG G GGGG G GG G G G G G G Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 716 XXGGGXPXGGRGXGG 672 GGG GG G GG Sbjct: 207 GYGGGGGYGGGGYGG 221 Score = 38.7 bits (86), Expect = 0.007 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -2 Query: 884 GGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGG 705 GGGG G G GGGG G G + G G G G G GG Sbjct: 123 GGGGRRGG---GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Query: 704 GXPXGGRGXGG 672 G GG G GG Sbjct: 180 GYGGGGHGGGG 190 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -3 Query: 880 GGXXXXGPGXGRXPXRAGGXXXXXAPXVFAXRGEXGGXXVCPXKGGGGGXXGGGXXXGGG 701 GG G G G GG + G GG G GGG GG GGG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGG----YGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Query: 700 XXXEGG 683 GG Sbjct: 223 RSGGGG 228 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 45.2 bits (102), Expect = 8e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = +1 Query: 673 PPXPLPPXG---XPPPXXXPXXXXXPXPPXXGKPXXPXFP-PSXQXXXGPXXXXPPPPXX 840 PP P PP G PPP P PP P P P S G PPPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 841 XPSPXRXXXSXPPPPXR 891 P PPPP R Sbjct: 980 SAPPPPPPPPPPPPPMR 996 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P PP G PP P P PP P PP P PPP P P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP--PPPPPGGSAPPPG 967 Query: 856 RXXXSXPPPP 885 PPPP Sbjct: 968 GGAPPLPPPP 977 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/77 (33%), Positives = 28/77 (36%), Gaps = 7/77 (9%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPP----FSPLXAXTXGAXSXXXPPARX 839 TP S PP PP PPPPP PP +P G + PP Sbjct: 903 TPGGSESPSASPPGGSVPP--PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG 960 Query: 840 GSLPXPG---PXXXXPP 881 GS P PG P PP Sbjct: 961 GSAPPPGGGAPPLPPPP 977 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPP 749 P PP PP PPP PPPPP Sbjct: 972 PLPPPPGGSAPPPPPPPP--PPPPP 994 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPL 788 PP PP PP PPPP PP L Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKL 998 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 661 SXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 S PP P PPP PP G P P PP P PPPP Sbjct: 943 SQPPPPGGNAPPPPPPP------GGSAPPPGGGAPPLPP-PPGGSAPPPPPPPPPPPP 993 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXG-----KPXXPXFPPSXQXXXG 807 PP P PP G PP P P PP G P P PP G Sbjct: 953 PPPPPPPGGSAPP---PGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -2 Query: 893 GRXGGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXX 714 G GGGG G G GGGG G GG G GG G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Query: 713 XGGGXPXGGRGXGG 672 GGG GG G GG Sbjct: 852 GGGGGGGGGGGGGG 865 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/75 (36%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = -2 Query: 893 GRXGGGGXXXXXRXGEGXXXGGGGXXXXG-PXXXCXEGGKXGXXGLPXXGGXGXXXXXGX 717 G GGGG G+G GGGG G +GG G G G G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Query: 716 XXGGGXPXGGRGXGG 672 GGG GG G GG Sbjct: 856 GGGGGGGGGGGGGGG 870 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/75 (36%), Positives = 28/75 (37%), Gaps = 1/75 (1%) Frame = -2 Query: 893 GRXGGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXX 714 G GGGG G G GGGG G +GG G G GG G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Query: 713 XG-GGXPXGGRGXGG 672 G GG G G GG Sbjct: 836 FGDGGGYADGDGGGG 850 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -2 Query: 893 GRXGGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXG-GXGXXXXXGX 717 G GGGG G G GGGG G GG G G G G G G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 716 XXGGGXPXGGRGXGG 672 GGG G G GG Sbjct: 837 GDGGGYADGDGGGGG 851 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/71 (36%), Positives = 26/71 (36%) Frame = -2 Query: 884 GGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGG 705 GGGG G G GGGG G GG G G G G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGG-----GGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Query: 704 GXPXGGRGXGG 672 G GG G GG Sbjct: 824 GGDGGGYGDGG 834 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/75 (34%), Positives = 28/75 (37%) Frame = -2 Query: 884 GGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGG 705 GGGG G+G G GG G +GG G GG G G GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG-------GGGGGGGGGGGGGGG 866 Query: 704 GXPXGGRGXGGXXNE 660 G GG G G NE Sbjct: 867 GGGGGGGGGGVIKNE 881 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -2 Query: 884 GGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGG 705 GGGG G GGGG G +GG G G GG G G GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG-DGDGGGGGGGGGGGGGGDGGG 829 Query: 704 GXPXGGRGXGG 672 GG G GG Sbjct: 830 YGDGGGFGDGG 840 Score = 37.1 bits (82), Expect = 0.021 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 884 GGGGXXXXXRXGEGXXXGGGGXXXXGPXXXCXEGGKXGXXGLPXXGGXGXXXXXGXXXGG 705 GGGG G G GGG G GG G G G G G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGD 846 Query: 704 GXPXGGRGXGG 672 G GG G GG Sbjct: 847 GGGGGGGGGGG 857 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 805 PXVFAXRGEXGGXXVCPXKGGGGGXXGGGXXXGGGXXXEGGXRG 674 P V G GG GGG G GGG GGG GG G Sbjct: 762 PVVAVVVGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/70 (34%), Positives = 27/70 (38%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 PLPP P P P PP + P PP + P PPPP P P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP----PPPPISKP-PTST 353 Query: 862 XXSXPPPPXR 891 + PPPP R Sbjct: 354 RSAPPPPPGR 363 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/79 (32%), Positives = 29/79 (36%) Frame = +1 Query: 655 QDSXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 +D PP PL PPP P PP G+ P PP + PPPP Sbjct: 304 RDQAPAPPPPLNAT-PPPPPPSRDQVPLPPPPLRGQIAPPP-PPISKPPTSTRSAPPPPP 361 Query: 835 XXXPSPXRXXXSXPPPPXR 891 P P PPPP R Sbjct: 362 GRAPQP--LGGPPPPPPGR 378 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 7/78 (8%) Frame = +1 Query: 673 PPXPLPPXGXPPPXX--XPXXXXXPXPPXXGKPXXPXFPPSXQXXXGP-----XXXXPPP 831 PP P G PPP P PP P PP P PPP Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 265 Query: 832 PXXXPSPXRXXXSXPPPP 885 P P P + S PPPP Sbjct: 266 PKNAPPPPKRGSSNPPPP 283 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXP-PPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPG 860 PP PPP P PPPP GQ PP P+ S PP P G Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP-PPISKPPTSTRSAPPPPPGRAPQPLGG 370 Query: 861 PXXXXP 878 P P Sbjct: 371 PPPPPP 376 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 12/80 (15%) Frame = +1 Query: 682 PLPPXGXPPPXXX-------PXXXXXPXPPXXGKPXXPXF-PPSXQXXXGPXXXXPPPPX 837 P PP G PPP P P PP GKP P P+ PPPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPH 199 Query: 838 XX----PSPXRXXXSXPPPP 885 P P PPPP Sbjct: 200 SRHGSAPPPPERSSGPPPPP 219 Score = 37.1 bits (82), Expect = 0.021 Identities = 27/85 (31%), Positives = 31/85 (36%), Gaps = 2/85 (2%) Frame = +1 Query: 655 QDSXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 +D PP PL PPP P P P P P Q GP PPPP Sbjct: 325 RDQVPLPPPPLRGQIAPPP---PPISKPPTSTRSAPPPPPGRAP--QPLGGPP---PPPP 376 Query: 835 XXXPSPXRXXXSXPPPP--XRPXFS 903 P + PPPP +P F+ Sbjct: 377 GRRPPSGKINPPPPPPPAMDKPSFT 401 Score = 35.1 bits (77), Expect = 0.085 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P G PP P PP G P P P PP P P Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRG-PSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Query: 853 XRXXXS--XPPPP 885 R S PPPP Sbjct: 254 MRGPTSGGEPPPP 266 Score = 35.1 bits (77), Expect = 0.085 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = +1 Query: 676 PXPLPPXGX---PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXP 846 P P PP G PPP P P PP P PP G PPP P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP-----PPK----RGSSNPPPPPTRGPP 289 Query: 847 SPXRXXXSXPPPPXR 891 S P PP R Sbjct: 290 SNSFTTQGPPLPPSR 304 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 678 RXPPSXXXPPPXXXPPPXX-PPPPPXXGQTXXPPFSPLXAXTXGAXS---XXXPPARXGS 845 R PP P PPP PPPP G + PP P + + PP+R + Sbjct: 249 RPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP-PPTRGPPSNSFTTQGPPLPPSRDQA 307 Query: 846 LPXPGPXXXXPP 881 P P PP Sbjct: 308 PAPPPPLNATPP 319 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 5/75 (6%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXX--PXPPXXGKPXXPXF---PPSXQXXXGPXXXXPPPPXX 840 P P PP P P P PP KP PP P PPPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 377 Query: 841 XPSPXRXXXSXPPPP 885 P PPPP Sbjct: 378 RRPPSGKINPPPPPP 392 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/69 (26%), Positives = 21/69 (30%) Frame = +3 Query: 678 RXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXP 857 R P PP P PPP + P P PP + GS P Sbjct: 222 RGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 281 Query: 858 GPXXXXPPT 884 P PP+ Sbjct: 282 PPPTRGPPS 290 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXX-XPPPPXXXPS 849 PP P PP P PP P P P PPPP Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Query: 850 PXRXXXSXPPPP 885 P + PPPP Sbjct: 380 PPSGKINPPPPP 391 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P PP PP P PP + P PP P P P R Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP--PPPLNATPPPPPPSRDQVPLPPPPLRG 337 Query: 862 XXSXPPPP 885 + PPPP Sbjct: 338 QIAPPPPP 345 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSP 785 PP P P PPP P P G+ PP P Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQ 761 I P S PPP P P PPPP G+ Sbjct: 346 ISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGR 378 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXP 747 P P PP G PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 677 PXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXPPXX 856 P P L TPPP P P P PP+ K PP P P Sbjct: 310 PPPPL-NATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 368 Query: 857 G 859 G Sbjct: 369 G 369 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/70 (34%), Positives = 27/70 (38%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 PLPP P P P PP + P PP + P PPPP P P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP----PPPPISKP-PTST 265 Query: 862 XXSXPPPPXR 891 + PPPP R Sbjct: 266 RSAPPPPPGR 275 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/79 (32%), Positives = 29/79 (36%) Frame = +1 Query: 655 QDSXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 +D PP PL PPP P PP G+ P PP + PPPP Sbjct: 216 RDQAPAPPPPLNAT-PPPPPPSRDQVPLPPPPLRGQIAPPP-PPISKPPTSTRSAPPPPP 273 Query: 835 XXXPSPXRXXXSXPPPPXR 891 P P PPPP R Sbjct: 274 GRAPQP--LGGPPPPPPGR 290 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 7/78 (8%) Frame = +1 Query: 673 PPXPLPPXGXPPPXX--XPXXXXXPXPPXXGKPXXPXFPPSXQXXXGP-----XXXXPPP 831 PP P G PPP P PP P PP P PPP Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 177 Query: 832 PXXXPSPXRXXXSXPPPP 885 P P P + S PPPP Sbjct: 178 PKNAPPPPKRGSSNPPPP 195 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXP-PPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPG 860 PP PPP P PPPP GQ PP P+ S PP P G Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP-PPISKPPTSTRSAPPPPPGRAPQPLGG 282 Query: 861 PXXXXP 878 P P Sbjct: 283 PPPPPP 288 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 12/80 (15%) Frame = +1 Query: 682 PLPPXGXPPPXXX-------PXXXXXPXPPXXGKPXXPXF-PPSXQXXXGPXXXXPPPPX 837 P PP G PPP P P PP GKP P P+ PPPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPH 111 Query: 838 XX----PSPXRXXXSXPPPP 885 P P PPPP Sbjct: 112 SRHGSAPPPPERSSGPPPPP 131 Score = 37.1 bits (82), Expect = 0.021 Identities = 27/85 (31%), Positives = 31/85 (36%), Gaps = 2/85 (2%) Frame = +1 Query: 655 QDSXXXPPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 +D PP PL PPP P P P P P Q GP PPPP Sbjct: 237 RDQVPLPPPPLRGQIAPPP---PPISKPPTSTRSAPPPPPGRAP--QPLGGPP---PPPP 288 Query: 835 XXXPSPXRXXXSXPPPP--XRPXFS 903 P + PPPP +P F+ Sbjct: 289 GRRPPSGKINPPPPPPPAMDKPSFT 313 Score = 35.1 bits (77), Expect = 0.085 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P G PP P PP G P P P PP P P Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRG-PSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Query: 853 XRXXXS--XPPPP 885 R S PPPP Sbjct: 166 MRGPTSGGEPPPP 178 Score = 35.1 bits (77), Expect = 0.085 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = +1 Query: 676 PXPLPPXGX---PPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXP 846 P P PP G PPP P P PP P PP G PPP P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP-----PPKR----GSSNPPPPPTRGPP 201 Query: 847 SPXRXXXSXPPPPXR 891 S P PP R Sbjct: 202 SNSFTTQGPPLPPSR 216 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 678 RXPPSXXXPPPXXXPPPXX-PPPPPXXGQTXXPPFSPLXAXTXGAXS---XXXPPARXGS 845 R PP P PPP PPPP G + PP P + + PP+R + Sbjct: 161 RPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP-PPTRGPPSNSFTTQGPPLPPSRDQA 219 Query: 846 LPXPGPXXXXPP 881 P P PP Sbjct: 220 PAPPPPLNATPP 231 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 5/75 (6%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXX--PXPPXXGKPXXPXF---PPSXQXXXGPXXXXPPPPXX 840 P P PP P P P PP KP PP P PPPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 289 Query: 841 XPSPXRXXXSXPPPP 885 P PPPP Sbjct: 290 RRPPSGKINPPPPPP 304 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/69 (26%), Positives = 21/69 (30%) Frame = +3 Query: 678 RXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXP 857 R P PP P PPP + P P PP + GS P Sbjct: 134 RGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 193 Query: 858 GPXXXXPPT 884 P PP+ Sbjct: 194 PPPTRGPPS 202 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXX-XPPPPXXXPS 849 PP P PP P PP P P P PPPP Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Query: 850 PXRXXXSXPPPP 885 P + PPPP Sbjct: 292 PPSGKINPPPPP 303 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P PP PP P PP + P PP P P P R Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP--PPPLNATPPPPPPSRDQVPLPPPPLRG 249 Query: 862 XXSXPPPP 885 + PPPP Sbjct: 250 QIAPPPPP 257 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSP 785 PP P P PPP P P G+ PP P Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQ 761 I P S PPP P P PPPP G+ Sbjct: 258 ISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGR 290 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 677 PXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXPPXX 856 P P L TPPP P P P PP+ K PP P P Sbjct: 222 PPPPL-NATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 280 Query: 857 G 859 G Sbjct: 281 G 281 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/74 (35%), Positives = 28/74 (37%), Gaps = 3/74 (4%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPP---SXQXXXGPXXXXPPPPXXXPSP 852 P P G PPP P P PP P PP S Q P PPPP +P Sbjct: 298 PPPSRGAPPPP--PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAP 355 Query: 853 XRXXXSXPPPPXRP 894 + PPPP P Sbjct: 356 PPVGGAAPPPPPPP 369 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/69 (33%), Positives = 26/69 (37%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P PPS PP P PPPPP G PP + + G PP+R P Sbjct: 287 PPPPPSRGAAPPP--PSRGAPPPPPSRGSAPPPPPARM-----GTAPPPPPPSRSSQRPP 339 Query: 855 PGPXXXXPP 881 P PP Sbjct: 340 PPSRGAPPP 348 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP P PPP P PP G P PPS P PPP P P Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP----PPSMGMAPPPVGGAAPPP---PPP 368 Query: 853 XRXXXSXPPPP 885 PPPP Sbjct: 369 PPVGGPPPPPP 379 Score = 37.1 bits (82), Expect = 0.021 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXP-PPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXG-SL 848 P P PPP PP PPPPP G PP P+ + PP G Sbjct: 346 PPPPSMGMAPPPVGGAAPPP-PPPPPVGGPPPPPP--PIEGRPPSSLGNPPPPPPPGRGA 402 Query: 849 PXPGP 863 P PGP Sbjct: 403 PPPGP 407 Score = 36.3 bits (80), Expect = 0.037 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P P G PPP P P P P P PP GP PPPP P Sbjct: 339 PPPSRGAPPP---PSMGMAPPPVGGAAPPPPPPPP----VGGPPP--PPPPIEGRPPSSL 389 Query: 862 XXSXPPPP 885 PPPP Sbjct: 390 GNPPPPPP 397 Score = 35.9 bits (79), Expect = 0.049 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXP--PPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSL 848 P PP+ P PP PPPP G P GA PP G Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Query: 849 PXPGPXXXXPP 881 P P P P Sbjct: 375 PPPPPPIEGRP 385 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPX---XXP 846 P P P G PP P PP + PPS P PPP P Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 364 Query: 847 SPXRXXXSXPPPPXRP 894 P PPPP P Sbjct: 365 PPPPPPVGGPPPPPPP 380 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXX----PPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXG 842 P PPS PP PPP PPPPP + PP A + PP Sbjct: 305 PPPPPSRGSAPP---PPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA 361 Query: 843 SLPXPGPXXXXPP 881 + P P P P Sbjct: 362 APPPPPPPPVGGP 374 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P P G PP P PP G P P P + PPPP +P Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 32.3 bits (70), Expect = 0.60 Identities = 24/70 (34%), Positives = 26/70 (37%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P PPS P PP PPPP G PP P+ A PP G P Sbjct: 327 PPPPPSRSSQRPP--PPSRGAPPPPSMGMA--PP--PVGG---AAPPPPPPPPVGGPPPP 377 Query: 855 PGPXXXXPPT 884 P P PP+ Sbjct: 378 PPPIEGRPPS 387 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXP----PPXX---PPPPPXXGQTXXPPFSPLXAXTXGAXS 815 P PP PPP P PP PPPPP G+ PP P+ G S Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP-GPMIPGRAGLLS 417 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLTQR 469 +C G +P PRSLTR RSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 23 ALMNRPTRGERRFAYW 38 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +1 Query: 688 PPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXG--PXXXXPPPPXXXPSPXRX 861 PP G PPP P P P G P FPP G P PPP P Sbjct: 236 PPMGAPPP---PHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNM 292 Query: 862 XXSXPPPP 885 PPPP Sbjct: 293 EQPPPPPP 300 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXP-PXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPS 849 PP +PP G PPP P P P G P PP P PPP S Sbjct: 243 PPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSS 302 Query: 850 PXRXXXSXPPPPXRP 894 PP P Sbjct: 303 GVSNSGMMPPHMQNP 317 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGA--XSXXXPPARXGSLPXP 857 PP PPP PPP PPP G P F P+ G PP G +P P Sbjct: 236 PPMGAPPPPHSMPPPGMPPP----GMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMP-P 290 Query: 858 GPXXXXPP 881 PP Sbjct: 291 NMEQPPPP 298 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 745 PPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPPPXRP 894 PP P P P PPPP P P PPP P Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFP 264 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/70 (35%), Positives = 28/70 (40%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 TP PP P P PP PPPP QT P P T + + PP +LP Sbjct: 905 TPAPPP----PLPLAPEPPPPLPPPPPPIQTTRPTV-PTTPTTQASTTRPTPPPPTSALP 959 Query: 852 XPGPXXXXPP 881 P P PP Sbjct: 960 PPIPATQVPP 969 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/74 (33%), Positives = 27/74 (36%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 PP PLP PPP P P P +P P P + P PPPP P Sbjct: 908 PPPPLPLAPEPPPPLPPP----PPPIQTTRPTVPTTPTTQASTTRPT---PPPPTSALPP 960 Query: 853 XRXXXSXPPPPXRP 894 PPPP P Sbjct: 961 PIPATQVPPPPLPP 974 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXP-PPPXXXPS 849 PP PLPP PPP P P PP P PPP P Sbjct: 918 PPPPLPP--PPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 850 PXRXXXSXPPPP 885 P PPPP Sbjct: 976 P------PPPPP 981 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSP 785 P P+ PPP P P PPPPP T P P Sbjct: 959 PPPIPATQVPPP---PLPPLPPPPPPVQTTTAPTLPP 992 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +2 Query: 659 THXXYPPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPL 790 T P P+ T P PP P P+ P PPL Sbjct: 932 TRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPX 855 P LPP PPP P PP P FPP P PPPP P P Sbjct: 451 PPQLPPNLPPPPGGM---RGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Query: 856 RXXXSXPPPP 885 R PP Sbjct: 508 RQRMPSQGPP 517 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P PP PP P P G P P PP+ G PPPP P R Sbjct: 428 PPPPQHTGPPQPRPPHGM----PQGGGP--PQLPPNLPPPPGGMRGMPPPPMGMYPPPR- 480 Query: 862 XXSXPPPPXRP 894 PPPP P Sbjct: 481 --GFPPPPFGP 489 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPX-XPPPP 746 PP PPP PPP PPPP Sbjct: 471 PPMGMYPPPRGFPPPPFGPPPP 492 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 702 PPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXP 857 PPP P P PP Q PP P PP G P P Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPP 479 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 682 PLPPXG-XPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPS 849 P PP G PPP P P PP P P P P PP PS Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQG--PPQVHYPS 523 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPX 854 P P PPP PP PPPPP PP SP P LP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPP-------PPPSPSPPRPPPPPPPSPPRPLAAKLPE 247 Query: 855 PGPXXXXPPT 884 P P PPT Sbjct: 248 PPPIPNMPPT 257 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +1 Query: 676 PXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPS 849 P P PP PPP P P PP +P P P PP P+ Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLPT 268 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 721 PXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPP-PXRP 894 P P PP P P PP P PPPP P P PPP P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP-SPPRPLAAKLPEPPPIPNMP 255 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLP 851 P PP PP PPP PP P + PP P T PP G LP Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPT-------LPPPTLGYLP 267 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPLXA 794 I P PP PP PPP PP P PP PL A Sbjct: 201 ITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP-RPLAA 243 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +1 Query: 673 PPXPLP-PXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPS 849 PP P P P PPP P P PP P P P + + P PP P+ Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPR-PLAAKLPEPPPIPNMPPTLPPPT 262 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 772 PXFPPSXQXXXGPXXXXPPPPXXXPSPXRXXXSXPPPPXRP 894 P P P PP P P P PPPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 121 ALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 245 ALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 83 ALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 70 ALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 95 ALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 52 ALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 82 ALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 200 ALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 42 ALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 41 ALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 342 ALMNRPTRGERRFAYW 357 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 739 PXPPXXGKPXXPXFPPS-XQXXXGPXXXXPPPPXXXPSPXRXXXSXPPPP 885 P PP KP P PP+ G PPPP P+ P PP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 672 TPRXPPSXXXPPPXXXPPPXXPPP--PPXXGQTXXPPFSP 785 TPR PP+ PP P P PPP P + PP P Sbjct: 788 TPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 197 ALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 97 ALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 83 ALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 560 ALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 316 ALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 159 ALMNRPTRGERRFAYW 174 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXPP 776 PR P PPP PPP PPPPP T P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 35.1 bits (77), Expect = 0.085 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 678 RXPPSXXXPPPXXXPPPXXPPPPP 749 R P PPP PPP PPPPP Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPP 882 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 705 PPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXG 806 P PPP PPPPP PP S + G Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGG 895 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 1/74 (1%) Frame = +1 Query: 676 PXPLP-PXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSP 852 P P P P P P P P P P PS P P P PS Sbjct: 477 PHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSD---PSPNPSSNPSSEPSPNPISNPSI 533 Query: 853 XRXXXSXPPPPXRP 894 S P P P Sbjct: 534 STSPISNPHPSSNP 547 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 702 PPPXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXG 806 P P PP PPPPP PP + T G Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPG 894 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 117 ALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 81 ALMNRPTRGERRFAYW 96 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 684 PPSXXXPPPXXXPPPXXPPPPPXXGQTXXPPFSPL 788 PP PPP PPP PPPPP PP +PL Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP-TPL 497 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPP 749 P PP PPP PPP PPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPP 749 P PP PPP PPP PPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 663 IXXTPRXPPSXXXPPPXXXPPPXXPPPP 746 + P PP PPP PPP PPPP Sbjct: 460 VGQAPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 808 PXXXXPPPPXXXPSPXRXXXSXPPPPXRP 894 P PPPP P P PPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFP 783 PP P PP PPP P P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPP----PPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 697 GXPPPXXXPXXXXXPXPPXXGKPXXPXFPP 786 G PP P P PP P P FPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 805 GPXXXXPPPPXXXPSPXRXXXSXPPPPXRP 894 G PPPP P P PPPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 677 PXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXP 775 P P P PPP PP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 808 PXXXXPPPPXXXPSPXRXXXSXPPPP 885 P PPPP P P PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 826 PPPXXXPSPXRXXXSXPPPPXRPXF 900 PPP P P PPPP P F Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPF 488 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 43 ALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 82 ALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 128 ALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 51 ALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 86 ALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 102 ALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 12 ALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 62 ALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 549 ALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 62 ALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 120 ALMNRPTRGERRFAYW 135 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 45 ALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 66 ALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 88 ALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 65 ALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 54 ALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 81 ALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 79 ALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 48 ALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 186 ALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 577 ALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 299 ALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 72 ALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 803 ALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 188 ALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 87 ALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 488 ALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 33 ALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 933 ALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 59 ALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 101 ALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 438 ALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 42 ALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 71 ALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 234 ALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 53 ALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 23 ALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 143 ALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 228 ALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 54 ALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 102 ALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 62 ALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 104 ALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 72 ALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNR TRGERRFA W Sbjct: 74 ALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 41 ALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 81 ALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 50 ALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 944 ALMNRPTRGERRFAYW 959 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 682 PLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPPXXXPSPXRX 861 P PP PP P P P P PP GP P P R Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRD 1719 Query: 862 XXSXPPPP 885 PP P Sbjct: 1720 GPMGPPGP 1727 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 671 YPPXPSLPXXTPPPXXPPXXXXXPXPLXXANPXXPXFPPLRKXXWGXXXXXPPRPXGXPP 850 YP P P P P P P P P P PP G P P G P Sbjct: 1659 YPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQG-IPGYPGAPAGPPG 1717 Query: 851 XXG 859 G Sbjct: 1718 RDG 1720 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/72 (29%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = +3 Query: 675 PRXPPSXXXPPPXXXPPPXXPPPPPXXGQTXXP--PFSPLXAXTXG-AXSXXXPPARXGS 845 P PP PP P P P G P P P G + PP R G Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGP 1721 Query: 846 LPXPGPXXXXPP 881 + PGP P Sbjct: 1722 MGPPGPSGGQGP 1733 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 91 ALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 424 ALMNRPTRGERRFAYW 439 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = +3 Query: 708 PXXXPPPXXPPPPPXXGQTXXPPFSPLXAXTXGAXSXXXPPARXGSLPXPGP 863 P PPP PPPPP GQ P P GA PP G+ P P P Sbjct: 656 PEAGPPP--PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +1 Query: 748 PXXGKPXXPXFPPSXQXXXGPXXXXPP-PPXXXPSPXRXXXSXPPPPXRPXF 900 P G P P PP Q P PP P P P PPP P F Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGF 707 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 702 PPPXXXPPPXXPPPPPXXGQTXXPPFSP 785 PPP P PPPPP G PP P Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 7/36 (19%) Frame = +3 Query: 702 PPPXXXPPPXX-------PPPPPXXGQTXXPPFSPL 788 PPP PPP PPPPP G PP P+ Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPI 695 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXGKPXXPXFPPSXQXXXGPXXXXPPPP 834 PP P PP PP P PP G P PP G PPPP Sbjct: 660 PPPPPPP---PPGGQAGGAPPPPPPPLPGGAAPPPPPP-----IGGGAPPPPPP 705 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 673 PPXPLPPXGXPPPXXXPXXXXXPXPPXXG 759 PP P P G PP P P PP G Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 106 ALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 472 ALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 79 ALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 470 ALMNRPTRGERRFAYW 485 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 92 ALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 50 ALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 50 ALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 94 ALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 101 ALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 240 ALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 120 ALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 1155 ALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 51 ALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 71 ALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 56 ALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 49 ALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 79 ALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 70 ALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 47 ALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 1425 ALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 578 ALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 38 ALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 275 ALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 123 ALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 487 ALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 40 ALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 109 ALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 93 ALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 93 ALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 131 ALMNRPTRGERRFAYW 146 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 748 GGGGGXXGGGXXXGGGXXXEGGXRG 674 GGGGG GGG GG +G G Sbjct: 86 GGGGGDGGGGGDGGGDGDGDGDGDG 110 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 61 ALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 103 ALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 42 ALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 68 ALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 64 ALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 494 ALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 389 ALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 42 ALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 176 ALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 61 ALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 44 ALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 43 ALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 46 ALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 586 ALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 40 ALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 26 ALMNRPTRGERRFAYW 41 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 377 VCVLGALPXPRSLTRCXRSFGCGERYQLT 463 +C G +P PRSLTR RSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 342 ALMNRPTRGERRFAYW 389 ALMNRPTRGERRFAYW Sbjct: 9 ALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,955,788 Number of Sequences: 59808 Number of extensions: 426667 Number of successful extensions: 9941 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5137 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -