BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B11 (969 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.18 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 29 0.98 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.5 bits (68), Expect = 0.18 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 278 AIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAP 171 AIA P +I+P ++RP S+F+KS A + +P Sbjct: 202 AIADPNIISPIDSVRPLLSLFIKSITSAISALILSP 237 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 29.1 bits (62), Expect = 0.98 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 215 LKSFH-LGSGAALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPIQYRSTRTLXNDQN 39 L+S H L S + T PR N + K + P ++ F+I + Y TR L QN Sbjct: 291 LQSVHYLISTISATLPRTLYNIVLFMVAAAKTVAPSVFATFAFRISVMYAVTRILPAIQN 350 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,541,573 Number of Sequences: 5004 Number of extensions: 45619 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 497299314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -