BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B09 (873 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) 29 3.8 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 29 6.6 SB_37335| Best HMM Match : Sigma54_activat (HMM E-Value=7.8) 29 6.6 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 28 8.7 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 28 8.7 >SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) Length = 822 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +2 Query: 158 HVPTRARRQAGSFTVNS---DGTSGAALKVPLTGNDKNVLSAIGSADFNDRHK 307 HVP + G + NS T G+ + +PL ++K V+ +G ND HK Sbjct: 526 HVP-KVGSHGGVYFWNSFRNKDTDGSLIVLPLKDHEKRVIGLLGVDTLNDSHK 577 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 28.7 bits (61), Expect = 6.6 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +2 Query: 293 NDRHKLSAA--SAGLALDNVNGHGLSLTGTRIPGFGEQLGVAGKVNLFHNNNHDLSA-KG 463 +DR+ L A S GL ++NG + +TG P + L + D SA KG Sbjct: 188 SDRYLLFTAQVSEGLDFSDINGRAVVITGLPFPPMMDAKVKLKMSFLDEMSRKDKSAIKG 247 Query: 464 VRDQELAQRHSQRAQLQHAGR 526 + +E ++ + RA Q GR Sbjct: 248 LTGREWYRQQASRAVNQAVGR 268 >SB_37335| Best HMM Match : Sigma54_activat (HMM E-Value=7.8) Length = 206 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -1 Query: 414 PATPSCSP--KPGMRVPVRLSPCPFTLSRASPA-EAALSLWRSLKSADPM 274 P TPSCSP + + +PVRL LS +P EA + L S+K+ P+ Sbjct: 10 PLTPSCSPLERDVLALPVRLG----GLSMTNPCLEADIELSSSVKATAPL 55 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/72 (26%), Positives = 27/72 (37%) Frame = -1 Query: 357 PCPFTLSRASPAEAALSLWRSLKSADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPACL 178 P P L R PA L L+ P S LP+ +P+ ++ P Sbjct: 619 PTPLPLERPVPAVTRLPTHLPLEQPVPAVTSLPTHLPLERPLPDVTRLPTHLPLERPVPA 678 Query: 177 RARVGTCLPLAK 142 R+ T LPL + Sbjct: 679 VTRLPTDLPLER 690 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 28.3 bits (60), Expect = 8.7 Identities = 23/87 (26%), Positives = 36/87 (41%) Frame = -1 Query: 429 NKLTLPATPSCSPKPGMRVPVRLSPCPFTLSRASPAEAALSLWRSLKSADPMALSTFLSL 250 + + + ATPS SP P VP L + ++P+ AA S+ + L T Sbjct: 218 SSVVVAATPSTSPVPATFVP-SLPTVASASTLSAPSVAASSIATPVNKTVVATLKTL--A 274 Query: 249 PVRGTFRAAPEVPSEFTVKLPACLRAR 169 PV R PS +++ P + R Sbjct: 275 PVVVVSRGVSISPSSSSIRTPVSIAVR 301 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,198,614 Number of Sequences: 59808 Number of extensions: 397890 Number of successful extensions: 1212 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -