BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B08 (930 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26000.2 68418.m03094 glycosyl hydrolase family 1 protein con... 31 0.82 At5g26000.1 68418.m03093 glycosyl hydrolase family 1 protein con... 31 0.82 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 29 4.4 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 29 4.4 At1g72110.1 68414.m08335 expressed protein 28 7.7 >At5g26000.2 68418.m03094 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to Myrosinase precursor (Sinigrinase) (SP:P37702) [Arabidopsis thaliana] Length = 456 Score = 31.5 bits (68), Expect = 0.82 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +1 Query: 94 MKFFMIFVLALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGN---GY-EPIDNGAYYVD 261 MK M+ + LLA+A +G+ + +N P+ N K +N +GN G+ + + AY V+ Sbjct: 1 MKLLMLAFVFLLALATCKGDEFVCEENEPFTCNQTKLFN-SGNFEKGFIFGVASSAYQVE 59 Query: 262 RPQGR 276 +GR Sbjct: 60 GGRGR 64 >At5g26000.1 68418.m03093 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to Myrosinase precursor (Sinigrinase) (SP:P37702) [Arabidopsis thaliana] Length = 541 Score = 31.5 bits (68), Expect = 0.82 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +1 Query: 94 MKFFMIFVLALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGN---GY-EPIDNGAYYVD 261 MK M+ + LLA+A +G+ + +N P+ N K +N +GN G+ + + AY V+ Sbjct: 1 MKLLMLAFVFLLALATCKGDEFVCEENEPFTCNQTKLFN-SGNFEKGFIFGVASSAYQVE 59 Query: 262 RPQGR 276 +GR Sbjct: 60 GGRGR 64 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +1 Query: 130 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 300 A N Q P + P P NP N Y+ +YYV + P +PT F Sbjct: 790 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 846 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +1 Query: 130 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 300 A N Q P + P P NP N Y+ +YYV + P +PT F Sbjct: 792 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 848 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 391 NSYEILKYIVNTLFRY*-FSKIFFTSHREHQGK 296 N+ I++ I NTL + FS I T H EH+GK Sbjct: 41 NASTIVEGIKNTLINHPRFSSILVTGHGEHKGK 73 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,371,070 Number of Sequences: 28952 Number of extensions: 244214 Number of successful extensions: 527 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2217402144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -