BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B07 (892 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 26 0.46 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.60 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 7.4 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 21 9.8 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 25.8 bits (54), Expect = 0.46 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 208 GARVVPGAAREPRHRPAH 261 G R PG AR RH PAH Sbjct: 327 GGRRGPGPARSRRHLPAH 344 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.4 bits (53), Expect = 0.60 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 306 CGISRPTTWRPCNTGTSDPRFLVGGNGKVYEGSG 407 C +PT WR C+ T + F + + + SG Sbjct: 878 CENGKPTCWRECDKATCEKLFRMKKSSALRPASG 911 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.3 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +1 Query: 85 APRHGPPPLGSCTRARSQLASHRNSSRLRRRQ*KAMGRFDPGARVVPGA 231 A +GP G TRA LA + R+++R DP R+ P A Sbjct: 2582 AKSYGPGEAGEFTRAGGFLAYYEICERVKKRGWTVTR--DPQGRIGPYA 2628 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -2 Query: 198 PSHCFLLTTSQSAAISVRSELRASASTTAEWRRAMSRSG 82 P HC A I+V++ + ++ S A W+ + +G Sbjct: 1191 PIHCQTEQDVPEAPIAVKALVMSTDSILASWKPPVEPNG 1229 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 299 ELVRNIQTNHMEALQYWD 352 EL + +TN M+ +Q+W+ Sbjct: 230 ELPQQHKTNVMDVMQWWE 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,889 Number of Sequences: 336 Number of extensions: 3597 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24720487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -