BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B05 (958 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0400 - 22608519-22608844,22609044-22609122 37 0.021 06_01_0486 - 3455030-3455770 33 0.25 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.8 12_02_1174 - 26696869-26698191 30 2.4 12_02_0299 - 17051570-17052474,17053542-17053755 30 2.4 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 3.1 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 3.1 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 3.1 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.1 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 29 5.5 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 29 5.5 11_06_0693 - 26334574-26336121 29 7.2 11_06_0232 + 21559467-21559532,21559586-21560200 29 7.2 09_03_0145 - 12749288-12751510 29 7.2 08_01_0059 - 394001-394708 29 7.2 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 7.2 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 28 9.6 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 28 9.6 02_05_0717 + 31190626-31191234,31191954-31192394,31192699-311928... 28 9.6 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 28 9.6 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -3 Query: 956 GXXRGXXGXGXEXXGGGXGXXGXGXXGGVXXXFXPPGXXVGXXXPXGP-XXXEPQWVNXR 780 G RG G G GGG G G G GG + PP G P GP P W R Sbjct: 61 GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWN--GGYYPPGPGHHHNPHWHGCR 118 >06_01_0486 - 3455030-3455770 Length = 246 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 871 TPPFXPXPKXPXPPPXXSXPXPXXP 945 TPP+ P P P PPP P P P Sbjct: 120 TPPYVPPPTPPSPPPYVPPPTPPSP 144 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXP 936 PP+ P P P PPP P P Sbjct: 133 PPYVPPPTPPSPPPYVPPPSP 153 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 835 PTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P + PP P P PPP P P P P Sbjct: 113 PPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSP 153 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 832 SPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 +P P PP P PK PPP P P P P Sbjct: 312 APPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGP 353 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 877 PFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P PK P PPP P P P P Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGP 362 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P K P PPP P P P Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPP 367 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPP 164 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 877 PFXPXPKXPXPPPXXSXPXPXXPL 948 P P P P PPP S P P PL Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFPPL 341 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 865 FXTPPFXPXPKXPXP-PPXXSXPXPXXP 945 F TPP P P P P PP P P P Sbjct: 249 FLTPPSPPPPAFPFPLPPWPWAPPPAFP 276 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 816 PPWSXXPNPXPWGXKXXXNXXXPPXPXXPXPXP 914 PP P P P G K + PP P P P P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P PL P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 835 PTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P G PP P P P PPP P P P P Sbjct: 94 PPPPPYGVNSSQPPP--PPPPPPSPPPSAPPPPPPPPTQPP 132 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 834 PNPXPWGXKXXXNXXXPPXPXXPXPXPXXFGPXXPXAP 947 P P P+G N PP P P P P P P P Sbjct: 94 PPPPPYGV----NSSQPPPPPPPPPSPPPSAPPPPPPP 127 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPL 948 PP P P P PPP P P P+ Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPI 380 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P P P PPP P P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPP 376 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P P P PPP P P P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPP 378 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXP 945 P SPT P TPP + P PPP P P P Sbjct: 56 PPPKPSPTPPPASPPPAPTPP---QTRPPSPPPQQQQPRPVSP 95 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 956 GXXRGXXGXGXEXXGGGXGXXGXGXXGGVXXXFXPPGXXVGXXXPXG 816 G G G G + GGG G G G GG PPG G G Sbjct: 15 GRGGGRGGGGGDGRGGGYGGAGGGGVGG-RGGRGPPGGGGGRGYEPG 60 >11_06_0693 - 26334574-26336121 Length = 515 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 119 FSWRLCMPTKPQSPTPNSKTIFTTASSLPITTIPLKR 229 F+ R C+P+ P SP +S SS P +PL R Sbjct: 49 FAVRHCLPSSPPSPHHHSLAALLLLSSPPPPALPLLR 85 >11_06_0232 + 21559467-21559532,21559586-21560200 Length = 226 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 155 SPTPNSKTIFTTASSLPITTIPLKRANRSTRTRRAKSSQMS*TNSYET 298 +P P ++T ASS P T P + +R R RRA+++Q +S T Sbjct: 141 TPRPRARTRGAPASSFPGATTPQRTPDR--RGRRARAAQQGEASSRAT 186 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PPF P P P PPP P P Sbjct: 19 PPFKPKPTNPSPPPPPPPPGIQPP 42 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 865 FXTPPFXPXPKXPXPPPXXSXPXPXXP 945 F P P P P PPP P P P Sbjct: 21 FKPKPTNPSPPPPPPPPGIQPPPPALP 47 >08_01_0059 - 394001-394708 Length = 235 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 886 PXPKXPXPPPXXSXPXPXXPLXXP 957 P P P PPP + P P P+ P Sbjct: 12 PPPATPPPPPRRAPPPPSPPIRPP 35 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXS-XPXPXXPLXXP 957 PP P P P PPP S P P P P Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P + P PPP S P P P Sbjct: 37 PPPPPRRRTPPPPPPGSGPGPQRP 60 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PPFXPXPKXPXPPP-XXSXPXPXXPLXXP 957 PP P P+ P PPP P P P+ P Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMP 292 >02_05_0717 + 31190626-31191234,31191954-31192394,31192699-31192802, 31193000-31194384,31194508-31194548,31195065-31195133, 31195335-31195435,31195747-31195825,31195939-31196037, 31196119-31196187,31197609-31197658,31197749-31197925, 31198045-31198152,31198224-31198290 Length = 1132 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 89 DENRSSYSCVFSWRLCMPTKPQSPTPNS 172 ++ + S S V SW +P +PQ PTP++ Sbjct: 44 EQRQPSASAVSSWLDSVPGRPQPPTPST 71 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 946 GAXGXXGPNXWGXGXGXXGXG 884 GA G GPN WG G G G Sbjct: 84 GAGGAGGPNKWGRGPGGADGG 104 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,464,934 Number of Sequences: 37544 Number of extensions: 374233 Number of successful extensions: 2687 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2363 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2764678640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -