BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_B05 (958 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 32 0.79 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.8 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.8 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 3.2 SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) 30 3.2 SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) 29 4.2 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 5.6 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 7.4 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 7.4 SB_36198| Best HMM Match : Kunitz_BPTI (HMM E-Value=3.6) 28 9.7 SB_25182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_7384| Best HMM Match : CXC (HMM E-Value=2.2e-05) 28 9.7 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP+ P P P PPP P P P P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 835 PTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXP 945 P P + PP+ P P P PPP + P P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPP-PNPPYPPPP 199 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP+ P P P PP P P P P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXS-XPXPXXPLXXP 957 PP+ P P P PPP + P P P P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 865 FXTPPFXPXPKXPXPPPXXSXPXPXXP 945 + PP+ P P P PP + P P P Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 835 PTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P + PP P P P PPP P P P P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPY-PPPPNPPYPPP 190 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP S P P P P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 31.9 bits (69), Expect = 0.79 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P SP P PP P P P PPP P P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 832 SPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 SP P +PP P P P PPP P P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P SP P PP P P P PPP P P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P+ P +PP P P P PPP P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P P PP P P P PPP P P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/83 (25%), Positives = 24/83 (28%) Frame = +3 Query: 699 KYDTTFXSXCTXPXIPRGVVXXXXXXXXXXXXXXFXXXXPPWSXXPNPXPWGXKXXXNXX 878 K D T+ + PR +V PP S P P P Sbjct: 335 KLDGTYMTKVVSVVNPRAIVTDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQ 394 Query: 879 XPPXPXXPXPXPXXFGPXXPXAP 947 PP P P P P P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPP 417 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP + P P P P Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P+ P PP P P P PPP P P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 P P P PP P P P PPP P P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 838 TXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXP 945 T G PP P P P PPP P P P Sbjct: 355 TDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPP 390 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPL 948 PP P P P PPP P P PL Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP P P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXP 945 P G P P G PP P P PPP P P P Sbjct: 162 PMGMQQPMGAPMGMCCMP-PPLNPYQPPPFPPPHLMYPQPTAP 203 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 814 GPXGXXSPTXXPG--GXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 GP G PG G +PP P P P PP P P PL P Sbjct: 696 GPPGQIGEMGPPGLPGPPGPASPPSPPGP--PGPPGPNGPPGPNGPLGPP 743 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 814 GPXGXXSPTXXPG--GXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 GP G PG G +PP P P P PP P P PL P Sbjct: 781 GPPGQVGEMGPPGLPGPPGPASPPSPPGP--PGPPGPKGPPGPNGPLGPP 828 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 814 GPXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 G G P PG +PP P P P PP P P PL P Sbjct: 614 GEIGEIGPAGLPGPPGP-ASPPSPPGP--PGPPGPKGPPGPNGPLGPP 658 >SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) Length = 776 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +1 Query: 121 FVASLYANETSVSDSKLEDDLYNSILVADYDHSVEKSKQIYEDKKSEVIT 270 F ASL A + S SDS EDDL ++ + DH K++ + + +K + T Sbjct: 548 FRASLAAQQDSTSDSSSEDDL----IMDEKDHPQGKARSLSDKQKCKNTT 593 >SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) Length = 592 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 192 HPRCRLRPFR*KEQTDLRGQEERSHHK----CRKQTHTKQQDELHGVRLPAMAPRLQRYR 359 HP +R +R Q RG+ ER HH CR +T Q + + ++RYR Sbjct: 145 HPGVAIRRYR-TRQVSQRGERERRHHPEVAICRYRTRQTGQSTRRTRKTTSSGVAIRRYR 203 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXPL 948 P G +P PGG PP P P PPP P P P+ Sbjct: 958 PPGGSAPP--PGGG----APPLPPPPGGSAPPPPPPPPPPPPPM 995 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXX-FXTPPFXPXPKXPXPPPXXSXPXPXXP 945 P SP+ PGG +PP P P PPP + P P P Sbjct: 894 PRRNESPSQTPGGSESPSASPPGGSVPPPP-PPPGGNAPLPPPP 936 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 817 PXGXXSPTXXP-GGXXXFXTPPFXPXPKXPXPPPXXSXPXPXXP 945 P G SP+ P GG PP P PPP S P P Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 835 PTXXPGGXXXFXTPPFXPXPKXPXPPPXXSXPXP 936 P PGG PP P PPP S P P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 871 TPPFXPXPKXPXPPPXXSXPXP 936 TPP P PK P PPP S P P Sbjct: 943 TPPPSPPPKEPTPPP-SSKPSP 963 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P P P PPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +1 Query: 817 PXGXXSPTXXPGGXXXFXTPPFXPXPKXP--XPPPXXSXPXPXXPLXXP 957 P P P PP P P P PPP + P P P P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P P P PP S P P P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNP 285 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXPLXXP 957 PP P P P PPP S P P P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXP 936 PP P P P PPP S P P Sbjct: 220 PPPSPSPPRPPPPPPPSPPRP 240 >SB_36198| Best HMM Match : Kunitz_BPTI (HMM E-Value=3.6) Length = 269 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 106 LFLCLFVASLYANETSVSDSKLEDDLYNSILVADYDHSVEKSKQ 237 LF C F +YA SV+ E +++ + + Y HS +SK+ Sbjct: 9 LFACQFTIVVYALFASVAPCYGESEVFLNDFLTPYHHSQRRSKR 52 >SB_25182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 283 KLIRNNKMNCMEYAYQLWLQGSKDIVRECF 372 +L NN+M +A+ WL+G + R+C+ Sbjct: 17 RLHNNNRMLICTFAHSTWLKGRQGSSRQCY 46 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 877 PFXPXPKXPXPPPXXSXPXPXXP 945 P P P+ P PPP + P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPP 803 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 874 PPFXPXPKXPXPPPXXSXPXPXXP 945 PP P K P PPP + P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPP 389 >SB_7384| Best HMM Match : CXC (HMM E-Value=2.2e-05) Length = 422 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 82 RKR*KPFKLFLCLFVASLYANETSVSDSKLEDDL 183 R+R K K ++CL++A + + + + +KLE + Sbjct: 314 RERSKAIKQYMCLYIAEVRVKQQNAAKTKLESQI 347 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,783,675 Number of Sequences: 59808 Number of extensions: 391463 Number of successful extensions: 2023 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1679 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -