BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A24 (1017 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 43 5e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.003 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 39 0.006 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.017 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.091 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 35 0.091 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 35 0.091 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 35 0.091 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.16 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 34 0.21 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 34 0.21 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 33 0.28 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 33 0.28 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.37 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 33 0.49 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.64 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.85 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.85 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.85 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 31 1.1 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.1 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 31 1.5 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 31 1.5 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 1.5 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 1.5 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 31 1.5 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 31 2.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 2.0 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 2.0 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 2.0 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 2.0 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 31 2.0 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 30 2.6 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 2.6 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 2.6 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 30 3.4 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 3.4 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 29 4.5 SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) 29 4.5 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 4.5 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 29 6.0 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 6.0 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 6.0 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 6.0 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 29 6.0 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 7.9 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 29 7.9 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 42.7 bits (96), Expect = 5e-04 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P+ PP PPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PS PP PPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P PP PPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P PP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PP PPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PP PPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P PP P PP PPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P PP P PP PPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP P PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 37.1 bits (82), Expect = 0.023 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPP 386 Score = 36.7 bits (81), Expect = 0.030 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PP PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPP 387 Score = 35.5 bits (78), Expect = 0.069 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPP-PPPPPSPPPPPQPPPPP 399 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PS PP PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PS PP PPPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 38.3 bits (85), Expect = 0.010 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPP 1182 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP + PP PPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P P PPPP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 290 PVPPP-PPADGSAPAPP--PPPPP 310 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PS PP PPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 35.9 bits (79), Expect = 0.052 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPP 227 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPP Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 36.3 bits (80), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P P PPPPP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 36.3 bits (80), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P P PPPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXP--PPPP 1012 P P PPP PP P PP P PPPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP PS PP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PP P PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P PPP PP P P P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG +G GG GGG G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG +G GG GGG G G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 853 GGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG GG GGG G G G Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG +G G GGG G Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG +G G GGG G G Sbjct: 820 GGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG GG +G GG GGG G G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GGG GG G GG GGG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGG 813 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG G G GG GGG G G G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G G G GG GGG G G G Sbjct: 804 GGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG GG GGG G G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFG 120 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG GG G GG GGG G G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.1 bits (77), Expect = 0.091 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P PP PPPP Sbjct: 139 PYPPSPNAPYP-PPPNPPYPPPLYPPPPNPPPP 170 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP P PPP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYP 117 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP P PPP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX-PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP P PPP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP PP P PP PPPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPP 112 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP + PP PPPP Sbjct: 152 PNPPYPPPLYP-PPPNPPPPNAPYPPPPYPPPP 183 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P P PPP P Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP + PP PP PP Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP + PP PP PP Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXP-PXXPPPP 1009 P P PPP PP P P P PPPP Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX-----PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPP P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PP PP Sbjct: 178 PYPPPPNPPYP-PPPNPPYPPPPNAPNPPPPNPP 210 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P P PP PP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP-PXXPSXXXPPXXPPPPP 1012 P P P PP P P P+ PP PPPP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP P P P P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPP 226 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPP--PXPPXXPSXXXPPXXPPPPP 1012 P P P PP P PP + PP PP PP Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PP PP P P P P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PP PP P P P P P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPP--PPNPPYPPPPNAP 123 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP P PPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPP----PPNPPYPPP 119 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP PP P PPP Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +2 Query: 941 PXPP-PXPPXXPSXXXP-PXXPPPP 1009 P PP P PP P+ P P PPPP Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP----PXXPSXXXPPXXPPPPP 1012 P P P PP P P P+ PP PPP P Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PP PPPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P PP PPPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P PP PPPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PPPPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P PPPPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PPP P P PP PP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPP--PPPPP 380 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPP--PPPPP 390 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPP--PPPPP 400 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPP--PPPPP 410 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +2 Query: 947 PPPXPPXXPSXXXPP--XXPPPPP 1012 PPP P P PP PPPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPP 369 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG GG G GG GGG G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG G G G Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G G G G Sbjct: 685 GGGGGGGGGGGGGGGGGAGGAGAG 708 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P P PPPPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P+ PP P P P Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPP--PPP 1012 P P P PP P P+ PP PP PPP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP 87 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX-PPXXPSXXXPPXXPPPPP 1012 P P P PP P P PP PPPPP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P P PPP P Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P P PP P+ P P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP P P P PPP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPP--PXPPXXPSXXXPPXXPPPP 1009 P P P PP P PP P+ PP PPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXX-PPPPP 1012 P P PP P+ PP PPPPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPP 245 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPP---PPP 1012 P P PPP PP P PP PP PPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PPPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP + P PPPPP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXX-PPPPP 1012 P PPP PP PP PPP P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP S P PPPPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPP 718 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PPPPP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P + PP PPPPP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP P + PP PPPP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P P PP P Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P P PPPPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PPPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPP 717 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P S P PPPPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPP 701 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +2 Query: 947 PPPXPP----XXPSXXXPPXXPPPPP 1012 PPP PP S PP PPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPP 702 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P P PPPPP Sbjct: 740 PPPPPPPPPGCAGLP--PPPPP 759 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG +G G GGG G G G Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG GG GGG G G G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGG G GG +G GG GGG G Sbjct: 89 GGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G GG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGG 110 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GGG GG G GG GGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GGG GG G GG GGG G Sbjct: 91 GDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGG 94 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG G G GG GGG G G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG G GG GGG G G G Sbjct: 79 GGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P P PPPPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P+ P PP PP Sbjct: 804 PTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PP PP P PP PPPPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GG G GG G GG GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGG 359 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP + PP PPP P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLP 684 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PP PPPP Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPP--PPPP 694 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPP 682 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPP 681 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP PP PS PP PP PP Sbjct: 1166 PPQPPPVPSVQAPPAPPPAPP 1186 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATG 84 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 63 GGGGGATGGGG--GATGGHGGATGGGGGATGDGG 94 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATG 98 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 70 GGGGGATGGHG--GATGGGGGATGDGGGATGGGG 101 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 98 GGGGGATGGGG--GATGGHGGATGGGVGATGGHG 129 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGGATG 133 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 93 PACPPACCAPPPPPPPPPP------PPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXP 998 PP PP PPP PP P Sbjct: 102 PPPPPPPPPPPPPPPPP 118 Score = 29.5 bits (63), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXP 998 PP PP PPP PP P Sbjct: 103 PPPPPPPPPPPPPPPPP 119 Score = 29.5 bits (63), Expect = 4.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXP 998 PP PP PPP PP P Sbjct: 104 PPPPPPPPPPPPPPPPP 120 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P PP PPPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PPPPP Sbjct: 867 PPPPPPPPPP---PPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PP PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPP----PPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 951 PXXPPXPPPXXXPPXPXXPXP 1013 P PP PPP PP P P P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPP 884 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPP 1006 P PPP PP PS P PPP Sbjct: 4 PPPPPGPPPPPSAPSGPVKPPP 25 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 31.9 bits (69), Expect = 0.85 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP PP P+ P PPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP PP P P PPPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP P PP PPPPP Sbjct: 62 PIPPTLPPPPPPP--PPPLPPPPP 83 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 64 PPTLPPPPPP---PPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP P PP PPPPP Sbjct: 286 PIPPTLPPPPPPP--PPPLPPPPP 307 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 288 PPTLPPPPPP---PPPPLPPPP 306 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG G GG GGG G G G Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G G GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGG 47 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P PP PPPPP Sbjct: 906 PAPPPPLPLAPEPP-PPLPPPPPP 928 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 947 PPPXPPXX-PSXXXPPXXPPPPP 1012 PPP P P PP PPPPP Sbjct: 959 PPPIPATQVPPPPLPPLPPPPPP 981 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP PPPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPP 926 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G GG GGG Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGG 1783 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G G GGG G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMG 1781 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P+ PP PPPP Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPP--PPPP 156 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P+ PP PPPP Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPP--PPPP 169 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PP P+ PP PPPP Sbjct: 114 PRAPETPSQAPSPPP-PPTSPATRAPP--PPPP 143 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP P P PP PPPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPP 208 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P PP PPPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP 209 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PPPP Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP P+ PPPPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PPPP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PPP PP P PPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PP PP S PP PPPPP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPP 992 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXX-PSXXXPPXX--PPPPP 1012 P P P PPP P PS PP PPPPP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 P P PP + PP PPPPP Sbjct: 972 PLPPPPGGSAPPPPPPPPPPPP 993 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP P PP PPPP Sbjct: 965 PPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP P P PPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PP P Sbjct: 182 PPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PP P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDP 202 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPP---PPP 1012 P P P PP PP PP PP PPP Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPP---PPP 1012 P P P PP PP PP PP PPP Sbjct: 186 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP S PPPPP Sbjct: 210 PPPPPPPPEDDSIHNHEDLPPPPP 233 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXP 1007 PP PP PPP PP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP PP P PP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PP PP P PP PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGG 102 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGG 946 GGGG GG G GG GGG Sbjct: 85 GGGGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG GG G GG GGG G G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 116 GGGGYGGGRGGGGYGGGRGGGYG 138 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 941 PXPP--PXPPXXPSXXXPPXXPPPPP 1012 P PP P P P PP PPPPP Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPP 206 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P+ P PPPPP Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GG G Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARG 1027 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYG 204 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG G G G GGG G G G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G GGG G Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGGYG 220 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP PP P PP PP PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPP 1279 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PP PPPPP Sbjct: 54 PPPPPPPP------PPPPPPPPPP 71 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP P P PP PPPP Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPP 1273 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDG 332 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PP PP P PP P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXG 940 GGGGG GG +G GG GGG G Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDG 474 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PPP PS P PPPP Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPPXXP-SXXXPPXXPPPPP 1012 P PPP P P S PP PPPP Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPP 1079 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP PP P+ PP PPPPP Sbjct: 311 PPPPPPEPTSELPP--PPPPP 329 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PPPPP Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPP 604 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 178 EAWLRRKSHEELGMSGRAREQP*HVQDEHEP 270 EAWL RK H E +S RE+ V+++H+P Sbjct: 223 EAWLERKEHREDSLSEHEREE---VKNKHKP 250 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGG GG +G GG GGG Sbjct: 90 GGGGDGDGGGGGDGGGGGDGGG 111 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P+ PP PPP P Sbjct: 424 PPPPPP--PAPLPPPPPPPPQP 443 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGG GG +G GG GGG Sbjct: 105 GGGGDGDGGGGGDGGGGGDGGG 126 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PPPPP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPP 368 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP PP PP PP Sbjct: 1028 PTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P PP PP P Sbjct: 1032 PTPPPTEPPTPPPTEPPTPPPTDP 1055 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGG G GG G GG GGG G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRG 173 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG G G GG GGG G G G Sbjct: 154 GRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG G +G GG GGG G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDG 27 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPP--XPPXXPSXXXPPXXPPP 1006 P P P PPP PP S PP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.4 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 7/41 (17%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPS-----XXXPP--XXPPPPP 1012 P P P PPP PP P+ PP PPPPP Sbjct: 299 PAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 948 PPXXPPX-PPPXXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 232 PPTAPPNTPPPPVTPPPPNTPGP 254 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP PP P PP PPPP Sbjct: 230 PKPPTAPPNTPP---PPVTPPPP 249 >SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) Length = 283 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 185 GFEENLMRNWVCLVEHESSRDTSKTN 262 GFEE + R W+ + E S D +KTN Sbjct: 33 GFEEEVKRQWIGCDKLEGSNDITKTN 58 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PPP PP PP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGG-GVPGPPKPPPP 683 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG EG GG GGG Sbjct: 399 GGGGGGGSAFGIEGGRGGHGGG 420 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP P PP PPPPP Sbjct: 65 PVPPTPLVQHPEPEAPPQLPPPPP 88 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP P PP PPPPP Sbjct: 724 PVPPTPLVQHPEPEAPPQLPPPPP 747 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG GG G GG GGG G G G Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGG 217 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGG 946 GGGG GG G GG GGG Sbjct: 207 GGGGYGGGRGGGGYGGGHGGG 227 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G GG GG Sbjct: 490 GGGGGASGGGGGGGGGGGFSGG 511 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 6.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -1 Query: 1011 GGGGGXXGGXXXEG---XXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGG 139 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 941 PXPPPX-PPXXPSXXXPPXXPPPP 1009 P PPP PP P PP PPP Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 G GGG GG G GG GGG Sbjct: 152 GRGGGGRGGGRGHGRGGGSGGG 173 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P P P P P Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +2 Query: 941 PXPPPXP----PXXPSXXXPPXXPPPPP 1012 P P P P P P PP PPPPP Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P S P PPPPP Sbjct: 686 PPPLPTPIASSEPLPLPPPPPP 707 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 951 PXXPPXPPPXXXPPXPXXP 1007 P PP PPP PP P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGP 1678 >SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) Length = 1142 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P P P PP S PP PP Sbjct: 433 PALPVRSGGTPVPQPPPPAADSIPTPPQPQPP 464 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 276 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 248 GGGGGATGGGG--GATGGGGGATGGGGGATGGGG 279 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 283 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 255 GGGGGATGGGG--GATGGGGGATGGGGGATGGGG 286 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 290 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 262 GGGGGATGGGG--GATGGGGGATGGGGGATGGGG 293 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 297 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 269 GGGGGATGGGG--GATGGGGGATGGGGGATGGGG 300 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 276 GGGGGATGGGG--GATGGGGGATGGGGGATGGGG 307 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 283 GGGGGATGGGG--GATGGGGGATGGGGGATGVGG 314 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 290 GGGGGATGGGG--GATGGGGGATGVGGGATGGGG 321 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVGATG 332 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 318 GGGGGATGGGV--GATGGGGGATGGGGGVTGGGG 349 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATG 353 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX-GGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 333 GGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 948 PPXXPPXPPP--XXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 103 PPTMPPTPPPPQTPAPPGPDTPAP 126 >SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 28.7 bits (61), Expect = 7.9 Identities = 22/78 (28%), Positives = 35/78 (44%) Frame = +2 Query: 182 HGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVK 361 H + +++W+ + E RDT+ N + ++N+ W K K +VK Sbjct: 53 HEADPVAVKSWLKKLSEEQFRDTADKYLRPNNCSHVVVPKVNEEIW-GKLTRQVKTKDVK 111 Query: 362 CSDLLTDDITKAAKCAKK 415 S L T +ITKA A K Sbjct: 112 FSRLQT-NITKAGHIAVK 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,614,257 Number of Sequences: 59808 Number of extensions: 415914 Number of successful extensions: 5198 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 1232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2840 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3023635215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -