BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A24 (1017 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 7e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 40 0.003 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.019 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 37 0.019 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 37 0.025 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 36 0.033 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.057 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 36 0.057 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.057 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 35 0.100 At1g61080.1 68414.m06877 proline-rich family protein 35 0.100 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 34 0.13 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 34 0.17 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.17 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.17 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 34 0.17 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 34 0.17 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 34 0.17 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 33 0.23 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.23 At4g01985.1 68417.m00265 expressed protein 33 0.23 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.23 At2g30560.1 68415.m03722 glycine-rich protein 33 0.23 At2g05440.2 68415.m00575 glycine-rich protein 33 0.23 At1g75550.1 68414.m08780 glycine-rich protein 33 0.23 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 33 0.30 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.40 At5g46730.1 68418.m05757 glycine-rich protein 33 0.40 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 33 0.40 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 33 0.40 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 33 0.40 At4g33660.1 68417.m04781 expressed protein 32 0.53 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.53 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 32 0.53 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 32 0.53 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 32 0.70 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 32 0.70 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 32 0.70 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.70 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 32 0.70 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 32 0.70 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 32 0.70 At1g02710.1 68414.m00222 glycine-rich protein 32 0.70 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 0.93 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 0.93 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 31 0.93 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 31 0.93 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 0.93 At1g04800.1 68414.m00476 glycine-rich protein 31 0.93 At4g34440.1 68417.m04894 protein kinase family protein contains ... 31 1.2 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 1.2 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 31 1.2 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.2 At4g16240.1 68417.m02464 hypothetical protein 31 1.2 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 31 1.2 At3g50180.1 68416.m05486 hypothetical protein 31 1.2 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 31 1.2 At2g05440.1 68415.m00574 glycine-rich protein 31 1.2 At1g70990.1 68414.m08190 proline-rich family protein 31 1.2 At1g26150.1 68414.m03192 protein kinase family protein similar t... 31 1.2 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 1.6 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 1.6 At4g30460.1 68417.m04325 glycine-rich protein 31 1.6 At3g55950.1 68416.m06217 protein kinase family protein contains ... 31 1.6 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 31 1.6 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 1.6 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 31 1.6 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 1.6 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 2.1 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 30 2.1 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 30 2.1 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 2.1 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 30 2.1 At4g33985.1 68417.m04822 expressed protein 30 2.1 At4g32340.1 68417.m04603 expressed protein 30 2.1 At1g62240.1 68414.m07021 expressed protein 30 2.1 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 30 2.1 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 30 2.1 At1g27710.1 68414.m03387 glycine-rich protein 30 2.1 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 30 2.1 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 2.8 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 2.8 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 30 2.8 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 30 2.8 At3g24550.1 68416.m03083 protein kinase family protein contains ... 30 2.8 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 30 2.8 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 30 2.8 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 30 2.8 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 30 2.8 At1g10620.1 68414.m01204 protein kinase family protein contains ... 30 2.8 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 3.7 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 29 3.7 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 3.7 At3g51290.1 68416.m05614 proline-rich family protein 29 3.7 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 29 3.7 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 29 3.7 At2g32080.2 68415.m03921 PUR alpha-1 protein identical to PUR al... 29 3.7 At2g32080.1 68415.m03920 PUR alpha-1 protein identical to PUR al... 29 3.7 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 3.7 At1g35617.1 68414.m04424 hypothetical protein 29 3.7 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 4.9 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 29 4.9 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 29 4.9 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 4.9 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 4.9 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 29 4.9 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 29 4.9 At2g05510.1 68415.m00583 glycine-rich protein 29 4.9 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 29 4.9 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 4.9 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 4.9 At1g11850.2 68414.m01364 expressed protein 29 4.9 At1g04660.1 68414.m00463 glycine-rich protein 29 4.9 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 6.5 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 29 6.5 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 29 6.5 At4g08230.1 68417.m01358 glycine-rich protein 29 6.5 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 6.5 At3g13590.1 68416.m01711 DC1 domain-containing protein contains ... 29 6.5 At3g08640.1 68416.m01003 alphavirus core protein family contains... 29 6.5 At3g08630.1 68416.m01002 expressed protein 29 6.5 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 6.5 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 6.5 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 6.5 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 6.5 At1g53625.1 68414.m06096 expressed protein 29 6.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 6.5 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 6.5 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 28 8.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 28 8.6 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 28 8.6 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 28 8.6 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 28 8.6 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 28 8.6 At1g15840.1 68414.m01901 expressed protein 28 8.6 At1g15830.1 68414.m01900 expressed protein 28 8.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP S PP PPPPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP S PP PPPPP Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP S PP PPPPP Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPP Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP P PP PPPPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P PP P PP PPPPP Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPPP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PP PPPPP Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P P PPPPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P P PPPPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 35.1 bits (77), Expect = 0.075 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXP----PPPP 1012 P P P PPP PP P PP P PPPP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 34.7 bits (76), Expect = 0.100 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPP--XXPPPPP 1012 P P P PPP PP S PP PPPPP Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +1 Query: 814 PXXXXPXXXXPPXXXXXXXXXXXXXXXXXPXXPXXPXXXXXXPXPPPXPPXXPLXPXXPX 993 P P PP P P P P PPP PP P+ P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 994 XPXXP 1008 P P Sbjct: 470 PPPPP 474 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P+ P P P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/73 (24%), Positives = 19/73 (26%) Frame = +1 Query: 790 PVFDXT*XPXXXXPXXXXPPXXXXXXXXXXXXXXXXXPXXPXXPXXXXXXPXPPPXPPXX 969 PV+ P P PP P P P P PP PP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Query: 970 PLXPXXPXXPXXP 1008 P P P P Sbjct: 494 VYSPPPPPPPPPP 506 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP P P PPPPP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPX---PPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPX---PPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPP Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P P PPPPP Sbjct: 581 PPPPIYPYLSPPPPPTPVSSP-PPTPVYSPPPPP 613 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/59 (25%), Positives = 16/59 (27%) Frame = +1 Query: 814 PXXXXPXXXXPPXXXXXXXXXXXXXXXXXPXXPXXPXXXXXXPXPPPXPPXXPLXPXXP 990 P P PP P P P P PPP PP P+ P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXP-----PPPP 1012 P P PPP P P PP P PPPP Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP P PP PPPP Sbjct: 552 PPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPP 584 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P P PPPPP Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPP 622 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P P P PPPPP Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P P+ PP PPPP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPP 434 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/70 (24%), Positives = 18/70 (25%) Frame = +1 Query: 790 PVFDXT*XPXXXXPXXXXPPXXXXXXXXXXXXXXXXXPXXPXXPXXXXXXPXPPPXPPXX 969 PV+ P P P P P P P PPP PP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Query: 970 PLXPXXPXXP 999 P P P Sbjct: 507 PPVYSPPPPP 516 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P P PPPPP Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRP--PPPPP 542 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPP---XXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPP---PPP 1012 P P P PPP PP P PP PP PPP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 35.1 bits (77), Expect = 0.075 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 34.7 bits (76), Expect = 0.100 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP P PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP + P P P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXP 990 P P P P PPP PP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXP 990 P P P P PPP PP P P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P P PPP PP P P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P PP PPPP Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 7/41 (17%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXX-----PSXXXPPXX--PPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PP PPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPP 64 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP P PP PPPPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP + PPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP P PPP PP P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPP 56 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P+ PP PPPPP Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPP 85 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 36.7 bits (81), Expect = 0.025 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P PP PPPPP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PP PPP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 35.1 bits (77), Expect = 0.075 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P P PP P PP PPPP Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 35.1 bits (77), Expect = 0.075 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPP P Sbjct: 73 PPSPPPCPPPPSPPPSPP-PPQLPPPPQLPPPAP 105 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P P Sbjct: 82 PPSPPPSPPPPQLPPPPQLPPP 103 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 920 PXXXXXXPXP-PPXPPXXPSXXXPPXXPPPP 1009 P P P PP PP P PP PPPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 920 PXXXXXXPXPPP-XPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PP PPP P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P PP PP PP Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P P PP PPPP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPP 74 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P+ PP PPP P Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCP 71 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXPXXP 1008 P P P PPP PP P P P P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P PP PPPPP Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 34.7 bits (76), Expect = 0.100 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P PP PPPPP Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP P PP PPPPP Sbjct: 1107 PSQPPPPPLSPPPSPPP--PPPPP 1128 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P PP PPPPP Sbjct: 1082 PSPPLPPSSLPPPPPAA-LFPPLPPPPSQPPPPP 1114 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PS PP PP PP Sbjct: 1069 PPPLPPLPPS--PPPPSPPLPP 1088 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP PS PP PPPP Sbjct: 1074 PLPPSPPP--PSPPLPPSSLPPPP 1095 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P P P PPPPP Sbjct: 1070 PPLPPLPPSPPPPSPPLP----PSSLPPPPP 1096 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPP--PP 1012 P P P PP PP P+ PP PPP PP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPP 1111 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPP 1003 P P P P PP P PP PP Sbjct: 274 PPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXX---PSXXXPPXXPPPPP 1012 P PPP PP PS PP PPPPP Sbjct: 600 PPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 35.1 bits (77), Expect = 0.075 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PS PP PPP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPP 596 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P+ P PPPPP Sbjct: 642 PPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PP PPPP Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPP 597 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPS--XXXPPXXPPPPP 1012 P P PPP PP PS P PPPPP Sbjct: 590 PLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP PP PPPP Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPP 721 Score = 31.9 bits (69), Expect = 0.70 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX---PPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPP 684 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX-----PPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX-PPXXPPPPP 1012 P PPP PP S P PPPPP Sbjct: 526 PPPPPPPPLFTSTTSFSPSQPPPPP 550 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP + P P PPP Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPP 703 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP PS PPPPP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPP 719 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX-----PPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 505 PPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +2 Query: 941 PXPPPXPPXXPS-----XXXPPXXPPPPP 1012 P PPP PP S PP PPPPP Sbjct: 619 PPPPPPPPSFGSTGNKRQAQPPPPPPPPP 647 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 34.7 bits (76), Expect = 0.100 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PPPPP Sbjct: 43 PPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPPPP Sbjct: 29 PPPPPMRRRAPLPPPPPP--PMRRRAPLPPPPPP 60 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P P PPPPP Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPP 46 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PPPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPP 45 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PP PPPPP Sbjct: 26 PPPPPPPPMRRRAPLPP--PPPPP 47 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 34.7 bits (76), Expect = 0.100 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P+ P PPPPP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPP 530 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP + PP PPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPP 530 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP + PP PPPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP + PP PPPP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPPXXP-SXXXPPXXPPPPP 1012 P PPP PP + PP PPPPP Sbjct: 438 PSPPPTPPIADIAISMPPPPPPPPP 462 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P P PPPPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P P PPPPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 31.9 bits (69), Expect = 0.70 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP + PP PPPPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPP--PPPPP 543 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P PP PPP P Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PPPPP Sbjct: 578 PPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P+ PPPP Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPP 477 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP P P P PPPPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPP 515 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPP---XXPPPPP 1012 P P PPP PP P P PPPPP Sbjct: 442 PTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPP 478 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PPPPP Sbjct: 593 PPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P P P PPP P Sbjct: 458 PPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P PP S P PPPPP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PP PPPP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP S P PPPPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PP PP + PP PPPP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPP 72 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPPP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPP--PPPPP 49 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP PP PPPP Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PP PPP P Sbjct: 32 PPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PPPP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPP 36 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPP---PPP 1012 P P PPP PP P PP PP PPP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PP PPPP Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = +2 Query: 920 PXXXXXXPXPPPX--PPXXPSXXXPPXXPP---PPP 1012 P P PPP PP P PP PP PPP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPP 447 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PP PPPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPP 85 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P PP P PP PPPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P PP PPPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PP P P PP PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG EG GG GGG G G G Sbjct: 125 GGGGGSYGGGRREGG-GGYGGGEGGGYGGSGGGG 157 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG EG GG GGG G G G Sbjct: 142 GGGGGSYGGGRREGG-GGYGGGEGGGYGGSGGGG 174 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -1 Query: 1011 GGGGGXX--GGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 98 GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 133 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PP PPPPP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPP--PPPPP 53 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP PS PP PPPPP Sbjct: 9 PPLPQPPSQNSLAPPPPP--PS--LPPPVPPPPP 38 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 6/40 (15%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX------PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PS PPPPP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P+ PPPPP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPP 731 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX---PPXXPPPPP 1012 P PP PP P+ PP PPPPP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPP 780 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PPPPP Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPP 712 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 941 PXPPPXPPXXPSXXX--PPXXPPPPP 1012 P PPP PP S PP PP PP Sbjct: 690 PPPPPPPPMQHSTVTKVPPPPPPAPP 715 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PPPP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPP 710 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPPXXP-SXXXPPXXPPPPP 1012 P PP PP P P PPPPP Sbjct: 770 PPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXP 981 P P P P PPP PP P P Sbjct: 714 PPAPPTPIVHTSSPPPPPPPPPPPAPP 740 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P PP PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP + PPPPP Sbjct: 51 PPPPPPPPQSHAAAYKRYSPPPPP 74 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVG 190 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 487 GGGGGIGGGAGGGVGGGVGGGVG 509 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GG GG GG G G GGG G G G Sbjct: 468 GGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG G G GG GGG G G G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 G GG GG G GG GGG G Sbjct: 337 GAGGGVGGGVGGGVGGGVGGGVG 359 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG GG GGG G G G Sbjct: 454 GGGGGSVGGGGRGS--GGAGGGTGGSVGAGGGVG 485 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGG 611 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 595 GGGGGYGGGGGYGGGGGYGGGYG 617 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 28 GGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GG GG GG G GG GGG Sbjct: 19 GGSGGGRGGGGGGGAKGGCGGG 40 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G G GGG G Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGG 32 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG G GG GGG G G Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSG 44 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGG GG G GG GGG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGG 31 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -1 Query: 1011 GGGGGXXGGXXX--EGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G Sbjct: 85 GGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCG 120 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 1011 GGG--GGXXGGXXXEGXXGGXGGGXG 940 GGG GG GG G GG GGG G Sbjct: 102 GGGKSGGGGGGGKNGGGCGGGGGGKG 127 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G G GGG G G G Sbjct: 105 GGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHG 138 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWG 94 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG GG G GG GGG G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 78 GGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG GG GGG G G G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P P PPPPP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPP 30 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PP PPPPP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPP 31 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P PP PPPPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 901 PXXPXXPXXXXXXPXPPPXPPXXPLXPXXPXXP 999 P P P P PPP PP P P P P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PPP PP P P P P Sbjct: 14 PPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGG 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GG GG GG G GG GGG G Sbjct: 138 GGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG G G GG GG G G G Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGG 165 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXX-EGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 174 GGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 260 GGGGSYGGEHGGGSGGGHGGGGG 282 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG G G G G G Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHG 230 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GG GG G GG GGG G G G Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G Sbjct: 254 GGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 G GGG GG G GG GGG G G G Sbjct: 192 GEGGGA-GGGGSHGGAGGYGGGGGGGSGGGGAYG 224 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GG GG EG GG GG G Sbjct: 55 GESGGGYGGGSGEGAGGGYGGAEG 78 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 1011 GGGGGXXG--GXXXEGXXGGXGGGXG 940 GGGGG G G G GG GGG G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGG 132 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G G G GG GGG G G Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 1011 GGGGGXXGGXXXEG--XXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSGGGHG 278 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P P PPPPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P PP PPP P Sbjct: 100 PQPPPPPQPLNLFSPPPPPPPPDP 123 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPPPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPP--PPPPP 705 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P P P PP PP PP Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P P PPP P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP-PXXPSXXXPPXXPPPPP 1012 P P P PPP P P P P P PPP Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXP-PPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PP PP PPP P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PP P PS P PPP Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPP 44 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PP PS P PP P Sbjct: 36 PKPQPKPPPAPSPSPCPSPPPKP 58 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P P P PP Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP P P PP PPPPP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPP 40 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P PP PPPPP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPP 41 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP PPPPP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP PPPPP Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPPP 44 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP PP PS P PPPP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPP 29 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P PP PPPPP Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P PP PPPP Sbjct: 83 PPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PS PP PPP P Sbjct: 41 PPPSPPPSPSS--PPRLPPPFP 60 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP PP P PP PPPP Sbjct: 64 PPEPPLPPRFELPPPLFPPPP 84 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG 123 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G G GGG G G G Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G GG GGG Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGG 174 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGG 169 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GGG GG G GG GGG G Sbjct: 96 GFGGGRGGGRGSGGGYGGGGGGYG 119 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.9 bits (69), Expect = 0.70 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP S P PPPPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPP 554 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P P PP PPPPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPP--PPPPP 564 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P PP PPPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPP 571 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXP--SXXXPPXXPPPPP 1012 P P P PP P P S PP PPPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PP PPPP Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGG 233 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G GG GGG Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGG 232 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P P P PP PPPP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P PS PP P PP Sbjct: 170 PTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP-PXXPSXXXPPXXPPPP 1009 P P PPP P P PS PP PPPP Sbjct: 88 PSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 120 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP-PXXPSXXXPPXXPPPP 1009 P P PPP P P PS PP PPPP Sbjct: 106 PSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 138 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP-PXXPSXXXPPXXPPPP 1009 P P PPP P P PS PP PPPP Sbjct: 124 PSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 156 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP P PS PP PPPP Sbjct: 83 PPPPTPSVPSPT-PPVSPPPP 102 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G GGG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGG 35 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GGG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGG 36 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP PS PP PPPPP Sbjct: 372 PPAPPGPANQTSPPPPPP--PSAAAPP--PPPPP 401 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX----PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPPPP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXP------PPPP 1012 P P P PPP P P+ PP P PPPP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP PP PPPP Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPP--PPPP 426 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP S PP PPPP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P PS P PPPPP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP PPPP Sbjct: 539 PMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXP---PPPP 1012 P P P PP P P PP P PPPP Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG GG GGG G Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEG 91 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 947 PPPXP-PXXPSXXXPPXXPPPPP 1012 PPP P P PS PP PPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAP 393 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP S P PPPPP Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 947 PPPXP-PXXPSXXXPPXXPPPPP 1012 PPP P P PS PP PPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAP 393 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP S P PPPPP Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPP 187 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPP---XXPPPPP 1012 P P P PPP PP P+ PP PPPPP Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P P P PP P PP PPPP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXP---PPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PP P PPPPP Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX---PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P+ P PPP P Sbjct: 135 PYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P P PP PPPP Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P PPPPP Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 920 PXXXXXXPXPP--PXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP + P PPPPP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXP 1007 PP P PPP PP P P Sbjct: 108 PPYVKPPPPPTVKPPPPPTP 127 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PPPPP Sbjct: 621 PLPPPLPPKKLLATTNPPPPPPPP 644 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP S PP PPPP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP PP P PPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP + PP PPPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPP--PPPP 637 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGG GG G GG GGG G G G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP PS P PP P Sbjct: 90 PSPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PS PP P P P Sbjct: 162 PLPPP-PPPYPSPLPPPPSPSPTP 184 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP P + PP PPPP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP P P PP PPPP Sbjct: 105 PPPPAITPPPPPAITPPLSPPPP 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PPPPP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPP 283 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP P P PP P PP Sbjct: 32 PPPPCICICNPGPPPPQPD-PQPPTPPTFQPAPP 64 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPP---XXPPPPP 1012 P P PPP PP PP PPPPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = +2 Query: 941 PXPPPX---PPXXPSXXX-PPXXPPPPP 1012 P PPP PP PS PP PPPPP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +2 Query: 941 PXPP----PXPPXXPSXXXPPXXPPPPP 1012 P PP P PP S PP PPPPP Sbjct: 316 PPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP PP PPPP Sbjct: 312 PPPPPPPPLLQQPPP-PPSVSKAPPPPPPPPPP 343 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG GG G GG GGG G Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGG 37 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PS P PP PP Sbjct: 125 PSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPP 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P P PP PP PS PP PP Sbjct: 138 PSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPP 169 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P PP P PS P PP P Sbjct: 128 PSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSP 160 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 941 PXPPPXPPXXP--SXXXPPXXPPPPP 1012 P PPP PP PP PPPPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPP 33 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 PP PP PPP PP P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 G GGG GG G GG GGG G Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGGG 59 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 83 GGGGGHYGGGG--GHYGGGGGGYGGGGGHHGGGG 114 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP P PS PP PP P Sbjct: 94 PSPPPPSPPPPSQACPPPPLPPSP 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PP PP PP Sbjct: 97 PPPSPPPPSQACPPPPLPPSPP 118 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPX--PPXXP-SXXXPPXXPPPPP 1012 P P PPP PP P + PP PPPPP Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P+ PP P PPP Sbjct: 141 PSPPTNPPPPPESPPSLPAPD-PPSNPLPPP 170 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P PP PPPPP Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP P PP PPPP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPP 387 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PS P PPPPP Sbjct: 52 PHQPPPSPYPHPHPP-PPSPYPHPHQPPPPP 81 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPP--PPP 1012 P P P P PP S PP PP PPP Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPP 46 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX-PP--XXPSXXXPPXXPPPPP 1012 P P P PPP PP P PP PPP P Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSP 59 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P P P P PPPPP Sbjct: 56 PPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGG-GXGXXXXXXGXXG 910 GGGGG GG G GG GG G G G G Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGGXG 940 GGGG G G GG GGG G Sbjct: 136 GGGGGSGNGEGYGEGGGYGGGYG 158 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPP 991 P P P PPP PP PS PP Sbjct: 361 PASPPSQFPLPPPPPPPPPSPSTSSPP 387 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPP---XXPPPPP 1012 P PPP PP PP PPPPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPP 256 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PP PPPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPP 539 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP PP PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPP 548 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P P PPPPP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPP 531 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P P PPPPP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPP 540 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPSXXXPPXXPPPPP 1012 P P P PPP PP PP PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P P PPPPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPP 514 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PP PPPP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPX--PPXXPS--XXXPPXXPPPPP 1012 P P P PPP PP P PP PPPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PS PP PPP P Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP PP P PP PPP Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPP 112 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 920 PXXXXXXPXPPPXP--PXXPSXXXPPXXPPPPP 1012 P P PPP P P PP PPPP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPP 93 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P PPPPP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPP 67 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP S P PPPP Sbjct: 47 PPPPPPPPLYFSYFSLPPPPPPP 69 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PPPP Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPPP 241 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXPXP 1013 P PP PPP PP P P P Sbjct: 381 PYGPPPGPPPMMRPPLPPGPPP 402 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP P P PP PP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPP 401 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 911 PXXPXXXXXXPX-PPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PP P P PPPPP Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEP-PSIPPPPPP 192 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PP PP PS PP PP PP Sbjct: 174 PSPPYFPPEPPSIPPPP--PPSPP 195 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG G G GG GGG G Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPG 324 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG G GG GG G G G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG G GG G GG GG G G G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGG G GG EG GG GGG G Sbjct: 138 GGGRGYGGGGRREG--GGYGGGDG 159 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G Sbjct: 104 GGGGGYSGGGGG-GYSGGGGGGYERRSGGYGSGG 136 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 148 HEMRSRA*AEEAWLRRKSHEELGMSGRAR 234 H A EEAWLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GG G GG +G GG GGG G Sbjct: 85 GGSNGGFGGRGGDGAGGGGGGGGG 108 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG +G G G G G Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G G G G Sbjct: 198 GGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSG 215 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXX-PSXXXPPXXPPPPP 1012 P P PP PP PS P PPPPP Sbjct: 47 PVAPLVPPGPPYAPPAQIPSSLLPTNLPPPPP 78 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP PPPP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPP 175 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPP---XXPPPPP 1012 P P P P PS PP PPPPP Sbjct: 158 PPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP--PXXPSXXXPPXX----PPPPP 1012 P P PPP P P PS PP PPPPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGGGG GG G GG GG G G Sbjct: 167 GGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PPPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPP 265 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PPPPP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPP 265 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PPPPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPP 264 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P PPP PP P PPPP Sbjct: 247 PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PP P PPPPP Sbjct: 246 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 941 PXPPPX--PPXXPSXXXPPXXPPPPP 1012 P PPP PP P P PPPPP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPP 92 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXP---PXXPSXXXPPXXPPPPP 1012 P P PPP P P P PP PPPP Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPP 1006 P P PP PP S PP PPP Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGX--GGGXGXXXXXXGXXG 910 GGGGG GG G GG GGG G G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G GGG G Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYG 596 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G G GGG G Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYG 596 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP PP P PP PPPP Sbjct: 217 PPPKPPSPP--RKPPPPPPPP 235 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P P PP P+ P PP P Sbjct: 148 PSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP P P+ PP P PP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPP 154 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP P PPPP Sbjct: 229 PQVKQSEPTPPPPPPSIAVKQSAPTPSPPPP 259 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP P PPPPP Sbjct: 240 PPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP P P PPP Sbjct: 26 PYPPPHPPVEVEENQPKTSPTPPP 49 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP P PPPPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPP 243 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PP PS PP P P P Sbjct: 70 PNQPPNTTPPPTPPSSPP--PSITPPPSPPQPQP 101 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPPP 1012 PP P PS PP PPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTP 282 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PP PP S PP PP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP P+ PP PP PP Sbjct: 51 PPPSPPPPSTPTTACPP--PPSPP 72 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 941 PXPP---PXPPXXPSXXXPPXXPPPP 1009 P PP P PP PS PP P PP Sbjct: 582 PSPPFTGPSPPSSPSPPLPPVIPSPP 607 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 4/38 (10%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPP----XXPPPPP 1012 P P P PPP P PP PPPPP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPP 795 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PPP PP P PPPP Sbjct: 110 PPPPPPPPSSTWDFWDPFIPPPP 132 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 948 PPXXPPXPPPXXXPPXPXXP 1007 P PP PPP PP P P Sbjct: 69 PSPSPPPPPPPRPPPPPLSP 88 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PPP PS P PPPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP PPPPP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPP 73 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP P P P PPPPP Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPP 755 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPPPX---PPXXPSXXXPPXXPPPPP 1012 P P PPP PP S PP PPPP Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXX--PPPPP 1012 P P P P PP P PP PPPPP Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 >At2g32080.2 68415.m03921 PUR alpha-1 protein identical to PUR alpha-1 GI:5081612 from [Arabidopsis thaliana]; contains Pfam profile: PF04845 PurA ssDNA and RNA-binding protein Length = 295 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGG 949 GGGGG GG G GG GG Sbjct: 6 GGGGGAEGGRAVTGGGGGGGG 26 >At2g32080.1 68415.m03920 PUR alpha-1 protein identical to PUR alpha-1 GI:5081612 from [Arabidopsis thaliana]; contains Pfam profile: PF04845 PurA ssDNA and RNA-binding protein Length = 296 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGG 949 GGGGG GG G GG GG Sbjct: 6 GGGGGAEGGRAVTGGGGGGGG 26 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 941 PXPPPXPP-XXPSXXXPPXXPPPPP 1012 P PP PP P+ PP PPP P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAP 122 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPP--PP 1012 PPP PP P P PPP PP Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPP 119 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 PPP PP S P PP PP Sbjct: 21 PPPAPPPESSSPPTPPEPPDPP 42 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 1008 GGGGXXGGXXXEGXXGGXGGG 946 GGGG GG G GG GGG Sbjct: 13 GGGGGGGGRFFGGGIGGGGGG 33 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G G GGG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGG 45 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G G GGG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGG 45 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PP + PPPPP Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 920 PXXXXXXPXPPPXPP-XXPSXXXPPXXPPPPP 1012 P P PPP PP P PP P PP Sbjct: 1127 PLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPP-----PPP 1012 PP PP PS PP PP PPP Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G G GGG Sbjct: 25 GGGGGHGGGGHGRGGHGRGGGG 46 >At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (ABI3) identical to abscisic acid-insensitive protein 3 GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant Cell 4 (10), 1251-1261 (1992)) Length = 720 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPP 1009 P PP P P PP PPPP Sbjct: 375 PNYPPQPEFLPLLESPPSWPPPP 397 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G G GGG Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGG 107 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXP---PXXPPPPP 1012 P P PP PS P P PPPPP Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPP 77 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPPP 1012 P PP P PP PPPPP Sbjct: 19 PHLHPPSAPLPPPPPLPPPPPP 40 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +2 Query: 911 PXXPXXXXXXPXPP-----PXPPXXPSXXXPPXXPPPPP 1012 P P P PP P PP S PP PPPP Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PPP PS P PPP P Sbjct: 434 PSVRAYSPPPPPYSKMSPSVRAYPPPPPPSP 464 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPP---XXPPPPP 1012 P P P PP S PP PPPPP Sbjct: 462 PSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPP 1009 PP PP P P PPPP Sbjct: 522 PPPPPPSPPPPCPESSPPPP 541 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP P PP P PPP Sbjct: 612 PPPPSPLYYPPVTPSPPPPSP-VYYPPVTPSPPP 644 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P P PP P PP P PPP Sbjct: 627 PPPPSPVYYPPVTPSPPPPSP-VYYPPVTPSPPP 659 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG GG GGG G Sbjct: 78 GGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG GG G GG GGG G Sbjct: 85 GGGGGLLGGG---GFGGGAGGGLG 105 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGG G GG G GG GGG G Sbjct: 157 GGGIGKAGGIGGLGGLGGAGGGLG 180 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGG G GG EG GG GGG G Sbjct: 74 GGGRGYGGGGRREG--GGYGGGDG 95 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GG GG GG G G GGG G Sbjct: 72 GGAGGGLGGGLGGGAGSGLGGGLG 95 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG G G GGG Sbjct: 131 GGGGGYGGGGGGYGGGGDGGGG 152 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1005 GGGXXGGXXXEGXXGGXGGGXG 940 GGG GG G GG GGG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRG 80 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPP 1009 PP PP P P PPPP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 >At3g13590.1 68416.m01711 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 513 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 225 TRHTQFLMRFSSKPCFLS---SCTRPHLVNVLASEPTQRTTKAKIINFCISIVSFE 67 TR+ L + SSK S S HLVNV E + R ++ I C S VSFE Sbjct: 6 TRNMMTLSKRSSKTKTGSVWFSYLEEHLVNVHIFEESPRDSRDAICKLCKSTVSFE 61 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG G GG GGG G Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFG 85 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG G GG GGG G Sbjct: 62 GGGGGSIGNHGGGSGSGGGGGGYG 85 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG GG +G GG GGG G G Sbjct: 288 GGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPP---PXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP S PP PPPP Sbjct: 70 PPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 920 PXXXXXXPXPP---PXPPXXPSXXXPPXXPPPPP 1012 P P PP P PP S PP PPPP Sbjct: 166 PPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 951 PXXPPXPPPXXXPPXPXXP 1007 P PP PPP PP P P Sbjct: 59 PSPPPPPPPQWGPPSPHYP 77 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 951 PXXPPXPPPXXXPPXPXXP 1007 P PP PPP PP P P Sbjct: 59 PSPPPPPPPQWGPPSPHYP 77 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGG G GG G GG GGG Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGG 88 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 911 PXXPXXXXXXPXPPPXPPXXPSXXXPPXXPPPP 1009 P P P P PP P PP PPPP Sbjct: 869 PPEPPPEMMPPPPQALPPPLP-HSHPPLVPPPP 900 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGGXG 940 GGGGG G G G GGG G Sbjct: 194 GGGGGGAGSYGGGGAGAGSGGGGG 217 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 950 PPXPPXXPSXXXPPXXPPPP 1009 P PP P PP PPPP Sbjct: 241 PSSPPQQPPATPPPPPPPPP 260 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P P PP PS PPPPP Sbjct: 49 PSPSMSPPPSPSLPLSSSPPPPPP 72 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 920 PXXXXXXPXPPPXPPXXPSXXXPPXXPPPPP 1012 P P P PP PS PP PP P Sbjct: 200 PSTSGYPPIPSAYPPPPPSSAYPPQPYPPQP 230 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 911 PXXPXXXXXXPXP-PPXPPXXPSXXXPPXXPPPP 1009 P P P P PP P P P PPPP Sbjct: 213 PPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 941 PXPPPXPPXXPSXXXPPXXPPPPP 1012 P PPP PP PPPPP Sbjct: 32 PLPPPLPPKKLLATTNTPPPPPPP 55 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 G GGG GG G GG GGG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGG 215 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 947 PPPXPPXXPSXXXPPXXPPPP 1009 PPP PP P P PPP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPP 92 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 1005 GGGXXGGXXXEGXXGGXGGGXGXXXXXXGXXG 910 GGG GG GG GGG G G G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDGISG 70 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 1011 GGGGGXXGGXXXEGXXGGXGGG 946 GGGGG GG GG GGG Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGG 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,804,486 Number of Sequences: 28952 Number of extensions: 318836 Number of successful extensions: 8453 Number of sequences better than 10.0: 136 Number of HSP's better than 10.0 without gapping: 1252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4693 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2499440136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -