BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A23 (951 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 9.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 9.4 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.8 bits (44), Expect = 9.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 441 NVLFQIQCEKYFDKFVFGA 385 N+L Q++C KY+ + A Sbjct: 316 NMLTQVECYKYYGNIMVNA 334 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 9.4 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -2 Query: 173 P*KLSTGAHLHWNSQRTLRKLISXELATVFTVLRFLCLIRN 51 P + S H HW + K LA ++++L + L+ N Sbjct: 35 PPEYSDLVHPHWRAFPAPGKHFHIGLAIIYSMLLIMSLVGN 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,767 Number of Sequences: 438 Number of extensions: 3531 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31202262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -