BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A21 (963 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.6 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 24 7.9 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.4 bits (53), Expect = 2.6 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 157 EEGQTGRNRPEAR*GAQAHG-GGLQSQKGEEGF 252 E GQ G P + A G GL+ QKGE GF Sbjct: 496 EPGQPGYGIPGQKGNAGMAGFPGLKGQKGERGF 528 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 23.8 bits (49), Expect = 7.9 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 68 HEPXGLT-QNLKEFRYXEVVXK 6 H+ LT QNL+EF+Y ++V K Sbjct: 46 HKTAELTYQNLQEFKYLDLVVK 67 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,885 Number of Sequences: 2352 Number of extensions: 9452 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 105843456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -