BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A20 (944 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 53 7e-08 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 40 4e-04 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 39 9e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 37 0.005 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 33 0.044 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 32 0.10 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 32 0.10 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 32 0.14 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 31 0.24 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 28 2.2 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 27 5.1 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 6.7 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 26 6.7 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 8.9 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 52.8 bits (121), Expect = 7e-08 Identities = 46/186 (24%), Positives = 50/186 (26%), Gaps = 3/186 (1%) Frame = +1 Query: 298 PXPPPXMGXKQGXPXRGKXGXXXXXPPPSXWAPXXXGGQXX---PXKNFXPPPPXXSXXX 468 P PPP +G P G PPP G ++ PPPP S Sbjct: 312 PPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPS 371 Query: 469 GGXXPPPXXGALPPXXXHXXQXPPRXXPGGTXXXXPXPPTKKNXXXXFPAXXXXXPPXPX 648 G PPP + PP P P P N A PP P Sbjct: 372 TGRQPPPLSSS------RAVSNPPAPPPAIPGRSAPALPPLGN------ASRTSTPPVPT 419 Query: 649 XXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXPXXXPXXXPXXPXXXXXPPXXXXXPP 828 P P P P P PP P P P PP PP Sbjct: 420 PPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPA-GMPAAPPLPPAAPAPPP 478 Query: 829 XXXPXP 846 P P Sbjct: 479 APAPAP 484 Score = 41.9 bits (94), Expect = 1e-04 Identities = 45/168 (26%), Positives = 48/168 (28%), Gaps = 3/168 (1%) Frame = +1 Query: 259 PXXXTGSXDXXFFPXPPPXMGXKQGXPXRGKXGXXXXXPPPSXWAPXXXGGQXXPXKN-- 432 P GS + P PPP G G PPP AP G Q P + Sbjct: 325 PPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP-STGRQPPPLSSSR 383 Query: 433 FXPPPPXXSXXXGGXXPPPXXGALPP-XXXHXXQXPPRXXPGGTXXXXPXPPTKKNXXXX 609 PP G P ALPP PP P P P + Sbjct: 384 AVSNPPAPPPAIPGRSAP----ALPPLGNASRTSTPPVPTPPSLPPSAP-PSLPPSAPPS 438 Query: 610 FPAXXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXP 753 P PP P PP P P P PP P P P P Sbjct: 439 LPMGAPAAPPLP-PSAPIAPPLPAGMPAAPPLPPAAPAPP-PAPAPAP 484 Score = 40.7 bits (91), Expect = 3e-04 Identities = 46/207 (22%), Positives = 47/207 (22%) Frame = +2 Query: 299 PLPPPXWGXNKGPXXGXKXXPFXXXPPPLLGPLXXXGXKXXPKKIFXPPPPXXPXXXXXX 478 PLPPP + K P PPP PPPP P Sbjct: 291 PLPPPSSRVSAAALAANKKRP-PPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAG 349 Query: 479 XXXXXXXXXXXXXXTGXXPPPGXXPGGXXXXXPPPXQKKXXFXXSXPXXXXPXPXPXPXX 658 PPP PPP S P P P P Sbjct: 350 SIPLPPQGR------SAPPPPPPRSAPSTGRQPPPLSSSRAV--SNP------PAPPPAI 395 Query: 659 XXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXX 838 P PP P P P P P PP P P P Sbjct: 396 PGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPI 455 Query: 839 PXXXPXXXXXXXPPXPXXPXPXPXXXP 919 P P P P P P P Sbjct: 456 APPLPAGMPAAPPLPPAAPAPPPAPAP 482 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 40.3 bits (90), Expect = 4e-04 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = -3 Query: 906 GXGXGXXGXGGXXXXXXXGXXXGXXXXGXXXXXXGXXXGGGGGGXGXXXXXXGGXGXXGG 727 G G G G G G G G G G GGG G GG G GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFE----GGPGGFGG 242 Query: 726 GXXGXXGXXXXXGGGXXGXXXXXXXGXGXG 637 G G G GGG G G G Sbjct: 243 GPGGFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 39.9 bits (89), Expect = 5e-04 Identities = 26/79 (32%), Positives = 26/79 (32%) Frame = -3 Query: 852 GXXXGXXXXGXXXXXXGXXXGGGGGGXGXXXXXXGGXGXXGGGXXGXXGXXXXXGGGXXG 673 G G G G GG GG G GG G GGG G G GGG G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGG-PG 245 Query: 672 XXXXXXXGXGXGXGXXXXG 616 G G G G G Sbjct: 246 GFGGGLGGFGGGPGGFGGG 264 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 39.1 bits (87), Expect = 9e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 638 PXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPP 793 P P P P P P P PP P PP P PPPPPP Sbjct: 732 PPPPPPAVIVPTPA-PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 644 PXPXXXXXXXPXXPPPXXXXXPXXPXX--PPPXXPXPPXXXXXXPXPPPPPP 793 P P P P P P PPP P P P PPPPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.1 bits (72), Expect = 0.059 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 638 PXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPP 790 P P P P P P PPP P P PPPPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 32.3 bits (70), Expect = 0.10 Identities = 18/72 (25%), Positives = 18/72 (25%) Frame = +2 Query: 686 PPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXX 865 PP P P P PP PPPPPP P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSR 791 Query: 866 XXXPPXPXXPXP 901 P P P Sbjct: 792 YYAPAPQAEPEP 803 Score = 29.9 bits (64), Expect = 0.55 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 575 PPPXQKKXXFXXSXPXXXXPXPXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPP 733 PPP P P P P P P PP P P PPP Sbjct: 732 PPPPPPAVIVPTPAPAPI-PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 29.5 bits (63), Expect = 0.72 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 632 PXPXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXP 805 P P P P PPP PPP P PP P P P Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEP 801 Score = 29.1 bits (62), Expect = 0.95 Identities = 22/93 (23%), Positives = 24/93 (25%) Frame = +2 Query: 374 PPPLLGPLXXXGXKXXPKKIFXPPPPXXPXXXXXXXXXXXXXXXXXXXXTGXXPPPGXXP 553 P PLL P + K + PPP P G PPP P Sbjct: 710 PSPLL-PDVSDTVEEQQKLLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Query: 554 GGXXXXXPPPXQKKXXFXXSXPXXXXPXPXPXP 652 G PPP P P P Sbjct: 769 GVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEP 801 Score = 27.9 bits (59), Expect = 2.2 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 439 PPPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXXPGGTXXXXPXP 582 P PP G PPP G PP GG+ P P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAP 797 Score = 27.5 bits (58), Expect = 2.9 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 776 PPPPPPXXXPXXXXXXPXXXXPXXXPXXXXXXXPPXPXXPXPXPXXXPXXXXXPP 940 PPPPPP P P P PP P P P PP Sbjct: 732 PPPPPPAVIVPTPAPAP---IPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/51 (27%), Positives = 14/51 (27%) Frame = +1 Query: 634 PPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXPXXXPXXXPXXP 786 PP P P P P PP P PP P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 26.6 bits (56), Expect = 5.1 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +3 Query: 438 PPPPXXXPXXGGGXTPPXXGGPP 506 PPPP P G PP PP Sbjct: 761 PPPPPPPPGVAGAGPPPPPPPPP 783 Score = 25.8 bits (54), Expect = 8.9 Identities = 13/40 (32%), Positives = 13/40 (32%), Gaps = 1/40 (2%) Frame = +1 Query: 637 PXPXXXXXXXPPPXXXXPXXPXXXPXXXXP-PXPXPPPXP 753 P P P P P P P P P PPP P Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 36.7 bits (81), Expect = 0.005 Identities = 33/135 (24%), Positives = 33/135 (24%) Frame = +2 Query: 536 PPGXXPGGXXXXXPPPXQKKXXFXXSXPXXXXPXPXPXPXXXXXXXPXXPPPXXXXXPXX 715 PP P G P P P P P P P PP Sbjct: 1112 PPVPAPSGAP---PVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAA 1168 Query: 716 PXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXXXXXPPXPXXP 895 P P P PP PP PPP P P P P PP P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAP--PVPKPSVGVP---PVPPPSTAPPVPTPS 1223 Query: 896 XPXPXXXPXXXXXPP 940 P PP Sbjct: 1224 AGLPPVPVPTAKAPP 1238 Score = 35.1 bits (77), Expect = 0.015 Identities = 36/150 (24%), Positives = 37/150 (24%), Gaps = 3/150 (2%) Frame = +1 Query: 439 PPPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXXPGGTXXXXPXPPTKKNXXXXFPA 618 PP P S P P PP P G P P + PA Sbjct: 1022 PPVPLPS---ADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPA 1078 Query: 619 XXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXP---PPXPXXXPXXXPXXPX 789 P P P P P P PP P P PP P P P Sbjct: 1079 PSGAPPVPAPSGIPPVPKPSVAAP--PVPKPSVAVPPVPAPSGAPPVP-KPSVAAPPVPV 1135 Query: 790 XXXXPPXXXXXPPXXXPXPXPXXXXPXXXP 879 PP P P P P P Sbjct: 1136 PSGAPP-VPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 30.7 bits (66), Expect = 0.31 Identities = 34/131 (25%), Positives = 36/131 (27%), Gaps = 4/131 (3%) Frame = +1 Query: 373 PPPSXWAPXXXGGQXXPXKNFXPPPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXXP 552 P PS AP P + PP P S P P PP PP P Sbjct: 1124 PKPSVAAPPV------PVPSGAPPVPKPSV---AAPPVPAPSGAPPVPKPSVAAPP--VP 1172 Query: 553 GGTXXXXPXPPTKKNXXXXFPAXXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPX 732 + P P P P P PPP P P PP Sbjct: 1173 APSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPT---PSAGLPPV 1229 Query: 733 PXP----PPXP 753 P P PP P Sbjct: 1230 PVPTAKAPPVP 1240 Score = 28.3 bits (60), Expect = 1.7 Identities = 32/142 (22%), Positives = 32/142 (22%), Gaps = 8/142 (5%) Frame = +2 Query: 536 PPGXXPGGXXXXXPPPXQKKXXFXXSXPXXXXPXPXPXP--XXXXXXXPXXPPPXXXXXP 709 P G P PP K P P P P P PP Sbjct: 1088 PSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSV 1147 Query: 710 XXPXXPPPXXPXPPXXXXXXPXPPPPPP----XXXPXXXXXXPXXXXPXXXP--XXXXXX 871 P P P PP PP P P P P P P Sbjct: 1148 AAPPVPAPSG-APPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVG 1206 Query: 872 XPPXPXXPXPXPXXXPXXXXXP 937 PP P P P P Sbjct: 1207 VPPVPPPSTAPPVPTPSAGLPP 1228 Score = 27.9 bits (59), Expect = 2.2 Identities = 30/128 (23%), Positives = 30/128 (23%), Gaps = 4/128 (3%) Frame = +2 Query: 536 PPGXXPGGXXXXXPP-PXQKKXXFXXSXPXXXXPXPXPXPXXXXXXX-PXXPPPXXXXXP 709 P P PP P P P P P P P PP Sbjct: 999 PVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAP-PIPVPSTAPPVPIPTSTPPVPKSSS 1057 Query: 710 XXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXXXXXPPXPX 889 P PPP P P P P PP P P PP P Sbjct: 1058 GAPSAPPPV-PAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPA 1116 Query: 890 X--PXPXP 907 P P Sbjct: 1117 PSGAPPVP 1124 Score = 27.5 bits (58), Expect = 2.9 Identities = 34/163 (20%), Positives = 38/163 (23%) Frame = +1 Query: 379 PSXWAPXXXGGQXXPXKNFXPPPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXXPGG 558 PS G + + PP P + PP PP P P Sbjct: 951 PSNDGRKASGPRPAAPPSIPPPLPVSNILSSPTSEPPKDH--PPSAP--LSKPVSTSPAA 1006 Query: 559 TXXXXPXPPTKKNXXXXFPAXXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPX 738 P P + P PP P P P P P P Sbjct: 1007 PLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPV 1066 Query: 739 PPPXPXXXPXXXPXXPXXXXXPPXXXXXPPXXXPXPXPXXXXP 867 P P P P PP P P P P P Sbjct: 1067 PAP-----SSEIPSIPAPSGAPP--VPAPSGIPPVPKPSVAAP 1102 Score = 26.6 bits (56), Expect = 5.1 Identities = 20/72 (27%), Positives = 20/72 (27%) Frame = +2 Query: 578 PPXQKKXXFXXSXPXXXXPXPXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXX 757 PP K P P P P P PPP P P P PP Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGV---PPVPPP-----STAPPVPTPSAGLPPVP 1230 Query: 758 XXXXPXPPPPPP 793 PP P P Sbjct: 1231 VPTAKAPPVPAP 1242 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 33.5 bits (73), Expect = 0.044 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 792 GGGGGGXGXXXXXXGGXGXXGGGXXGXXGXXXXXGGGXXGXXXXXXXGXGXGXG 631 GG GG G GG G GGG G G G G G G G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSG 62 Score = 29.1 bits (62), Expect = 0.95 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -3 Query: 804 GXXXGGGGGGXGXXXXXXGGXGXX-GGGXXGXXGXXXXXGGGXXG 673 G GG GG G GG G GGG G G GG G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 29.1 bits (62), Expect = 0.95 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 804 GXXXGGGGGGXGXXXXXXGGXGXXGGGXXGXXGXXXXXGGGXXG 673 G G GG G GG G GG G G GG G Sbjct: 27 GFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 27.1 bits (57), Expect = 3.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 804 GXXXGGGGGGXGXXXXXXGGXGXXGGGXXGXXGXXXXXGGGXXG 673 G G GGG G GG GG G G GG G Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 32.3 bits (70), Expect = 0.10 Identities = 32/142 (22%), Positives = 32/142 (22%) Frame = +1 Query: 442 PPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXXPGGTXXXXPXPPTKKNXXXXFPAX 621 PPP G PPP P H P PG P PP P Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEP--GEHMPPPPMHHEPG---EHMPPPPMHHEPGEHMPPP 262 Query: 622 XXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXPXXXPXXXPXXPXXXXX 801 P PPP P P P PP P P Sbjct: 263 PMHHEPGEHMP----PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHH 318 Query: 802 PPXXXXXPPXXXPXPXPXXXXP 867 P PP P P Sbjct: 319 EPGEHMPPPPMHHEPGEHMPPP 340 Score = 26.6 bits (56), Expect = 5.1 Identities = 29/133 (21%), Positives = 29/133 (21%) Frame = +1 Query: 469 GGXXPPPXXGALPPXXXHXXQXPPRXXPGGTXXXXPXPPTKKNXXXXFPAXXXXXPPXPX 648 G PPP P H P PG P PP P P Sbjct: 204 GEHMPPPPMHHKP--GEHMPPPPMHHEPG---EHMPPPPMHHEPGEHMPPPPMHHEPGEH 258 Query: 649 XXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXPXXXPXXXPXXPXXXXXPPXXXXXPP 828 PPP P P P PP P P P PP Sbjct: 259 MP----PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 314 Query: 829 XXXPXPXPXXXXP 867 P P Sbjct: 315 PMHHEPGEHMPPP 327 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 32.3 bits (70), Expect = 0.10 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 716 PXXPPPXXPXPPXXXXXXPXPPPPP 790 P PPP P P P PPPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.9 bits (69), Expect = 0.14 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 716 PXXPPPXXPXPPXXXXXXPXPPPPPP 793 P PP P PP PPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 25.8 bits (54), Expect = 8.9 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +2 Query: 728 PPXXPXPPXXXXXXPXPPPPPPXXXP 805 PP P PP P PPP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.9 bits (69), Expect = 0.14 Identities = 20/77 (25%), Positives = 20/77 (25%), Gaps = 1/77 (1%) Frame = +2 Query: 674 PXXPPPXXXXXPXXPXXPPPXXPXP-PXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXX 850 P P P P P P P P P P PP P P P Sbjct: 128 PAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 851 PXXXXXXXPPXPXXPXP 901 P P P P P Sbjct: 188 PSLPSAVPPMPPKVPPP 204 Score = 31.1 bits (67), Expect = 0.24 Identities = 20/78 (25%), Positives = 20/78 (25%), Gaps = 1/78 (1%) Frame = +2 Query: 611 SXPXXXXPXPXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPP-XXPXPPXXXXXXPXPPPP 787 S P P P P PPP P P PP PP P PP Sbjct: 126 SAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Query: 788 PPXXXPXXXXXXPXXXXP 841 P P P Sbjct: 186 SAPSLPSAVPPMPPKVPP 203 Score = 31.1 bits (67), Expect = 0.24 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 4/77 (5%) Frame = +2 Query: 575 PPPXQKKXXFXXSXPXXXXPXPXPXPXXXXXXXPXXPP-PXXXXXPXXPXXP---PPXXP 742 PP Q + S P P P P PP P P P P PP P Sbjct: 130 PPTPQSELRPPTSAPPRPS-IPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAP 188 Query: 743 XPPXXXXXXPXPPPPPP 793 P P PPPP Sbjct: 189 SLPSAVPPMPPKVPPPP 205 Score = 29.5 bits (63), Expect = 0.72 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 4/81 (4%) Frame = +2 Query: 707 PXXPXXPPPXXPX-PPXXXXXXPXPPPPPPX---XXPXXXXXXPXXXXPXXXPXXXXXXX 874 P P P P PP P PPP P P P P P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Query: 875 PPXPXXPXPXPXXXPXXXXXP 937 P P P P P P Sbjct: 185 PSAPSLPSAVPPMPPKVPPPP 205 Score = 27.9 bits (59), Expect = 2.2 Identities = 26/118 (22%), Positives = 27/118 (22%), Gaps = 1/118 (0%) Frame = +2 Query: 536 PPGXXPGGXXXXXPPPXQKKXXFXXSXPXXXXPXPXPXPXXXXXXXPXXPPPXXXXXPXX 715 PP P P P + P P P P P P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP 198 Query: 716 PXXPPPXXPXPP-XXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXXXXXPPXP 886 P PPP P P PP P P P P PP P Sbjct: 199 PKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESP--KFPNRGPSIPSASVPPVP 254 Score = 27.5 bits (58), Expect = 2.9 Identities = 21/85 (24%), Positives = 23/85 (27%) Frame = +1 Query: 574 PXPPTKKNXXXXFPAXXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXP 753 P PPT ++ P P P PP P P P P P P Sbjct: 128 PAPPTPQSELRP-PTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPP------PAQPAAP 180 Query: 754 XXXPXXXPXXPXXXXXPPXXXXXPP 828 P P P P PP Sbjct: 181 VKSPPSAPSLPSAVPPMPPKVPPPP 205 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 31.1 bits (67), Expect = 0.24 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 667 PPPXXXXPXXPXXXPXXXXPPXPXPPPXP 753 PPP P P P PP PPP P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 29.9 bits (64), Expect = 0.55 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +2 Query: 707 PXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXXXXXPPXP 886 P P PP P PPPPP P P P P PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAP------PPPLP 1736 Query: 887 XXPXP 901 P Sbjct: 1737 ASSAP 1741 Score = 27.9 bits (59), Expect = 2.2 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 683 PPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPP 790 PP P P P P P P PPPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 26.6 bits (56), Expect = 5.1 Identities = 12/39 (30%), Positives = 12/39 (30%) Frame = +2 Query: 674 PXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPP 790 P PP P P P PP P PP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP 1724 Score = 25.8 bits (54), Expect = 8.9 Identities = 12/40 (30%), Positives = 12/40 (30%) Frame = +2 Query: 674 PXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPP 793 P P P P P PP P PP PP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPP 1722 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 27.9 bits (59), Expect = 2.2 Identities = 15/58 (25%), Positives = 15/58 (25%) Frame = +2 Query: 632 PXPXPXPXXXXXXXPXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXP 805 P P P P P P P P PPPPPP P Sbjct: 190 PPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPPTLP 247 Score = 26.2 bits (55), Expect = 6.7 Identities = 22/92 (23%), Positives = 22/92 (23%), Gaps = 10/92 (10%) Frame = +2 Query: 674 PXXPPPXXXXXPXXPXXPPPXX-PXPPXXXXXXPXPPPPPP---------XXXPXXXXXX 823 P P P PP P P PPPPPP P Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSS 215 Query: 824 PXXXXPXXXPXXXXXXXPPXPXXPXPXPXXXP 919 P P P P P P P P Sbjct: 216 GRAVSPEIPPTYTPKQADPLPAPPPPPPPTLP 247 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 26.6 bits (56), Expect = 5.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 786 GGGGXGXXXXXXGGXGXXGGGXXGXXG 706 GGG G GG G GGG G G Sbjct: 112 GGGHHGPLHGPHGGFGGRGGGRMGGRG 138 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 26.2 bits (55), Expect = 6.7 Identities = 27/116 (23%), Positives = 28/116 (24%), Gaps = 11/116 (9%) Frame = +1 Query: 439 PPPPXXSXXXGGXXPPPXXGALPPXXXHXXQXPPRXX-PGG----------TXXXXPXPP 585 P PP + G P G LP P R PG T PP Sbjct: 850 PLPPPSTSTTAGWNDAPMLGQLPMRRAAPSMAPVRSPFPGASSAQPAAMSRTSSVSTLPP 909 Query: 586 TKKNXXXXFPAXXXXXPPXPXXXXXXXPPPXXXXPXXPXXXPXXXXPPXPXPPPXP 753 A PP P PP P P P P P P Sbjct: 910 PPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAPQSP 965 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 26.2 bits (55), Expect = 6.7 Identities = 16/65 (24%), Positives = 16/65 (24%) Frame = +2 Query: 686 PPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXPXXXXXXPXXXXPXXXPXXXX 865 PP P P P P P P P PP P P P Sbjct: 494 PPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIPG 553 Query: 866 XXXPP 880 PP Sbjct: 554 ATAPP 558 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 25.8 bits (54), Expect = 8.9 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +2 Query: 674 PXXPPPXXXXXPXXPXXPPPXXPXPPXXXXXXPXPPPPPPXXXP 805 P PP P P P P P P PP P P Sbjct: 104 PREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.147 0.530 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,267,762 Number of Sequences: 5004 Number of extensions: 41616 Number of successful extensions: 412 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 481321826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -