BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A19 (880 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 42 3e-05 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 32 0.020 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 32 0.020 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 32 0.020 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 32 0.020 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 32 0.020 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 32 0.020 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 32 0.020 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 32 0.020 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 32 0.020 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 32 0.020 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 32 0.020 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 32 0.020 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 32 0.020 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 32 0.020 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 32 0.020 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 32 0.020 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 32 0.020 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 32 0.020 AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding pr... 26 1.3 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 25 3.0 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 24 7.0 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 24 7.0 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 9.3 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 9.3 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +1 Query: 232 EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 + ++V+F+A WCG CK +AP+ + K A++ I + KVD + ++L + +P Sbjct: 21 QLVVVDFFATWCGPCKVIAPKLEEFQNKYADK---IVVVKVDVDECEELAAQYNIASMP 76 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 133 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 133 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 135 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 135 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 138 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 138 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 148 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 150 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 150 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 132 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 132 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.3 bits (70), Expect = 0.020 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++ FYA WC C A + K L E I A V+A E+ L R++ +P Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTL--EPYGITFATVNAGHEEQLVRKVGVHSLP 147 >AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding protein AgamOBP19 protein. Length = 136 Score = 26.2 bits (55), Expect = 1.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 580 SFRTRAQPEPKLSFQLAQVVDDXVFAIVSDEK 675 +FR QP+ K+S ++A V+ VFA D K Sbjct: 28 TFRQVCQPKHKISDEVADAVNRGVFADTKDFK 59 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 25.0 bits (52), Expect = 3.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 241 LVEFYAPWCGHCKSLAPEY 297 +V YAP C CKS+ Y Sbjct: 21 MVFAYAPTCARCKSIGARY 39 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 23.8 bits (49), Expect = 7.0 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +1 Query: 130 AIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEF-----YAPWCGHCKSLAPE 294 A+ L L + N L ++ + I+T E +F A W CK+ AP Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192 Query: 295 YA 300 YA Sbjct: 193 YA 194 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 23.8 bits (49), Expect = 7.0 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +1 Query: 130 AIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEF-----YAPWCGHCKSLAPE 294 A+ L L + N L ++ + I+T E +F A W CK+ AP Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192 Query: 295 YA 300 YA Sbjct: 193 YA 194 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 9.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 554 INKFFSLFSRRDLNSRGASLLLQPTDDVISLTTT*IVDR 438 +++F+ L + +L ASL+ T IS+ T ++DR Sbjct: 319 LSRFYFLITPMNLPEANASLVANLTATTISVLGTLLLDR 357 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 263 GAATASLWRRNTPRQP 310 G T +LWRRN +P Sbjct: 181 GTRTTTLWRRNNDGEP 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,516 Number of Sequences: 2352 Number of extensions: 13163 Number of successful extensions: 93 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -