BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A19 (880 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 97 1e-20 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 97 1e-20 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 91 9e-19 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 91 1e-18 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 91 1e-18 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 77 2e-14 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 77 2e-14 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 73 2e-13 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 73 2e-13 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 63 3e-10 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 62 5e-10 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 62 5e-10 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 54 1e-07 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 54 2e-07 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 48 1e-05 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 44 1e-04 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 44 2e-04 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 44 2e-04 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 42 4e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 42 4e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 42 4e-04 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 5e-04 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 42 5e-04 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 42 7e-04 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 41 0.001 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 41 0.001 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 41 0.001 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 40 0.002 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 40 0.002 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 39 0.004 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 39 0.004 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 39 0.005 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 38 0.007 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 38 0.007 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 38 0.007 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 38 0.012 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 38 0.012 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 38 0.012 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 38 0.012 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 38 0.012 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 37 0.015 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 37 0.020 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 37 0.020 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 36 0.036 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 36 0.047 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 35 0.062 At3g19780.1 68416.m02504 expressed protein 33 0.19 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 33 0.25 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 32 0.44 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 32 0.58 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 32 0.58 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 32 0.58 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 31 0.77 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 31 0.77 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.77 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 31 0.77 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 31 1.0 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 31 1.3 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 29 3.1 At4g30160.1 68417.m04289 villin, putative similar to villin 2 (... 29 5.4 At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein si... 28 9.5 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 9.5 At3g55605.1 68416.m06176 mitochondrial glycoprotein family prote... 28 9.5 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 97.5 bits (232), Expect = 1e-20 Identities = 48/93 (51%), Positives = 64/93 (68%), Gaps = 4/93 (4%) Frame = +1 Query: 142 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAA 309 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 310 TKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 T+L +E + LAK+DAT+E +L +E R P Sbjct: 147 TEL--KEDGVVLAKIDATEENELAQEYRVQGFP 177 Score = 55.6 bits (128), Expect = 4e-08 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = +1 Query: 160 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 330 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L + Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 331 SPIKLAKVDATQEQ 372 S + + K+D T + Sbjct: 493 S-LVITKMDGTTNE 505 Score = 44.8 bits (101), Expect = 8e-05 Identities = 16/53 (30%), Positives = 33/53 (62%) Frame = +3 Query: 429 NGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFS 587 +G Y+GGR + I++W+KKK GP +T+ + A++++ + +V G+ + Sbjct: 184 DGEHKPYTGGRTKETIVTWVKKKIGPGVYNLTTLDDAEKVLTSGNKVVLGYLN 236 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 97.5 bits (232), Expect = 1e-20 Identities = 48/93 (51%), Positives = 64/93 (68%), Gaps = 4/93 (4%) Frame = +1 Query: 142 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAA 309 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 310 TKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 T+L +E + LAK+DAT+E +L +E R P Sbjct: 147 TEL--KEDGVVLAKIDATEENELAQEYRVQGFP 177 Score = 55.6 bits (128), Expect = 4e-08 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = +1 Query: 160 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 330 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L + Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 331 SPIKLAKVDATQEQ 372 S + + K+D T + Sbjct: 493 S-LVITKMDGTTNE 505 Score = 44.8 bits (101), Expect = 8e-05 Identities = 16/53 (30%), Positives = 33/53 (62%) Frame = +3 Query: 429 NGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFS 587 +G Y+GGR + I++W+KKK GP +T+ + A++++ + +V G+ + Sbjct: 184 DGEHKPYTGGRTKETIVTWVKKKIGPGVYNLTTLDDAEKVLTSGNKVVLGYLN 236 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 91.1 bits (216), Expect = 9e-19 Identities = 45/105 (42%), Positives = 66/105 (62%), Gaps = 4/105 (3%) Frame = +1 Query: 124 FTAIALLGLALGD--EVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 297 F+ + LL L + T+E VL L +NF IS ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 298 AKAATKLAEEESPIKLAKVDATQE--QDLXRELRCTRIPDSQILQ 426 KAA++L+ P+ LAK+DA++E ++ E + P +IL+ Sbjct: 69 EKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILR 113 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = +1 Query: 166 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 336 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP + A + S Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSV 425 Query: 337 IKLAKVDAT 363 I +AK+DAT Sbjct: 426 I-IAKLDAT 433 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/67 (35%), Positives = 42/67 (62%) Frame = +3 Query: 423 SGNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQSSA 602 +G S DY+G R+A+ I+++LKK++GP +VE+ SA+ A E++ V+ G F S Sbjct: 114 NGGKSVQDYNGPREAEGIVTYLKKQSGPASVEIKSADSATEVVGEKNVVAVGVFPKLSGD 173 Query: 603 RAKTFLS 623 +F++ Sbjct: 174 EFDSFMA 180 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 90.6 bits (215), Expect = 1e-18 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%) Frame = +1 Query: 103 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 270 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 271 HCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 HCK LAPEY KAA+ L+ P+ LAK+DA++E Sbjct: 61 HCKQLAPEYEKAASALSSNVPPVVLAKIDASEE 93 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +1 Query: 166 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 336 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP + A + +S Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSY-QSDSS 426 Query: 337 IKLAKVDAT 363 + +AK+DAT Sbjct: 427 VVIAKLDAT 435 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/67 (32%), Positives = 43/67 (64%) Frame = +3 Query: 423 SGNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQSSA 602 +G + +Y+G R+A+ I+++LKK++GP + E+ SA+ A E++ V+V G F S + Sbjct: 115 NGGKAVQEYNGPREAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGS 174 Query: 603 RAKTFLS 623 +F++ Sbjct: 175 EFDSFMA 181 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 90.6 bits (215), Expect = 1e-18 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%) Frame = +1 Query: 103 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 270 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 271 HCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 HCK LAPEY KAA+ L+ P+ LAK+DA++E Sbjct: 61 HCKQLAPEYEKAASALSSNVPPVVLAKIDASEE 93 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +1 Query: 166 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 336 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP + A + +S Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSY-QSDSS 426 Query: 337 IKLAKVDAT 363 + +AK+DAT Sbjct: 427 VVIAKLDAT 435 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/67 (32%), Positives = 43/67 (64%) Frame = +3 Query: 423 SGNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQSSA 602 +G + +Y+G R+A+ I+++LKK++GP + E+ SA+ A E++ V+V G F S + Sbjct: 115 NGGKAVQEYNGPREAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGS 174 Query: 603 RAKTFLS 623 +F++ Sbjct: 175 EFDSFMA 181 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 77.0 bits (181), Expect = 2e-14 Identities = 36/83 (43%), Positives = 52/83 (62%) Frame = +1 Query: 160 DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 339 D+ + VL L+ +NF++ IST + I V+FYAPWCGHCK L PE AA LA+ + PI Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPI 85 Query: 340 KLAKVDATQEQDLXRELRCTRIP 408 +AK++A + L R++ P Sbjct: 86 VIAKLNADKYSRLARKIEIDAFP 108 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 76.6 bits (180), Expect = 2e-14 Identities = 36/78 (46%), Positives = 50/78 (64%) Frame = +1 Query: 175 EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKV 354 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L + LAK+ Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL---KGLAALAKI 154 Query: 355 DATQEQDLXRELRCTRIP 408 DAT+E DL ++ P Sbjct: 155 DATEEGDLAQKYEIQGFP 172 Score = 52.0 bits (119), Expect = 5e-07 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 3/95 (3%) Frame = +1 Query: 97 DNIAMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWC 267 +NI F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 268 GHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQ 372 GHC+S P Y K L +S + +AK+D T + Sbjct: 468 GHCQSFEPIYNKLGKYLKGIDS-LVVAKMDGTSNE 501 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +3 Query: 447 YSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFS 587 Y G R D I++WLKKK P +T+ E+A+ ++ A +VFGF + Sbjct: 186 YEGERTKDGIVTWLKKKASPSIHNITTKEEAERVLSAEPKLVFGFLN 232 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +1 Query: 178 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKV 354 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE + +A + Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEG-VVIANL 199 Query: 355 DATQEQDLXRELRCTRIP 408 DA + L + + P Sbjct: 200 DADAHKALGEKYGVSGFP 217 Score = 70.9 bits (166), Expect = 1e-12 Identities = 38/99 (38%), Positives = 56/99 (56%) Frame = +1 Query: 121 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 300 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 301 KAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 K + +S + +AKVD +++ + + + P Q Sbjct: 64 KLGASFKKAKS-VLIAKVDCDEQKSVCTKYGVSGYPTIQ 101 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 444 DYSGGRQADDIISWLKKKTG 503 DY GGR DD +S++ +K+G Sbjct: 231 DYDGGRDLDDFVSFINEKSG 250 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 383 ESYGVRGYPTLKFF 424 E YGV G+PTLKFF Sbjct: 209 EKYGVSGFPTLKFF 222 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = +1 Query: 178 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKV 354 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +EE + +A + Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEG-VVIANL 199 Query: 355 DATQEQDLXRELRCTRIP 408 DA + L + + P Sbjct: 200 DADAHKALGEKYGVSGFP 217 Score = 70.9 bits (166), Expect = 1e-12 Identities = 38/99 (38%), Positives = 56/99 (56%) Frame = +1 Query: 121 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 300 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 301 KAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 K + +S + +AKVD +++ + + + P Q Sbjct: 64 KLGASFKKAKS-VLIAKVDCDEQKSVCTKYGVSGYPTIQ 101 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 444 DYSGGRQADDIISWLKKKTG 503 DY GGR DD +S++ +K+G Sbjct: 231 DYDGGRDLDDFVSFINEKSG 250 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 383 ESYGVRGYPTLKFF 424 E YGV G+PTLKFF Sbjct: 209 EKYGVSGFPTLKFF 222 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +1 Query: 193 LSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 L+ +NF E V + E +VEF+APWCGHCK LAPE+ KAA L + +KL V+ E Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL---KGKVKLGHVNCDAE 224 Query: 370 QDLXRELRCTRIP 408 Q + + P Sbjct: 225 QSIKSRFKVQGFP 237 Score = 55.6 bits (128), Expect = 4e-08 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = +1 Query: 184 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDA 360 VL L+ +NF++ V+++ +LVEF+APWCGHC+SL P + K A+ L + +A +DA Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL---KGIATVAAIDA 86 Query: 361 TQEQDLXRELRCTRIPDSQI 420 + + ++ P ++ Sbjct: 87 DAHKSVSQDYGVRGFPTIKV 106 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 62.1 bits (144), Expect = 5e-10 Identities = 37/97 (38%), Positives = 49/97 (50%), Gaps = 7/97 (7%) Frame = +1 Query: 157 GDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 330 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKERY 191 Query: 331 SP-----IKLAKVDATQEQDLXRELRCTRIPDSQILQ 426 P + LAKVD TQE DL R P +I + Sbjct: 192 DPEMDGRVILAKVDCTQEGDLCRRNHIQGYPSIRIFR 228 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 62.1 bits (144), Expect = 5e-10 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +1 Query: 193 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L + +KL V+ E Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL---QGKVKLGHVNCDVE 223 Query: 370 QDLXRELRCTRIP 408 Q + + P Sbjct: 224 QSIMSRFKVQGFP 236 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +1 Query: 184 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDA 360 V+ L+ +NF++ V+++ +LVEF+APWCGHCK+L P + K A L + +A +DA Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL---KGVATVAAIDA 88 Query: 361 TQEQDLXRELRCTRIPDSQI 420 Q ++ P ++ Sbjct: 89 DAHQSAAQDYGIKGFPTIKV 108 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/75 (34%), Positives = 40/75 (53%) Frame = +1 Query: 184 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDAT 363 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E S + +AK+D Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSVLMAKIDGE 136 Query: 364 QEQDLXRELRCTRIP 408 + + +L P Sbjct: 137 RYSKVASQLEIKGFP 151 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/59 (28%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +3 Query: 429 NGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFF--SDQSS 599 NG+ Y+GG +++I+ W++KKTG +++ + ++A + + + G F S+ SS Sbjct: 158 NGTSQSYTGGFSSEEIVIWVQKKTGASTIKLDTVDEASGFLKKHHTFILGLFEKSEDSS 216 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 53.6 bits (123), Expect = 2e-07 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = +3 Query: 429 NGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQSSARA 608 NG+ + Y+GG A+DI+ W++KKTG P + + + ++A +D V G F + Sbjct: 160 NGTSLTYNGGSSAEDIVIWVQKKTGAPIITLNTVDEAPRFLDKYHTFVLGLFEKFEGSEH 219 Query: 609 KTFLSTGSS 635 F+ S Sbjct: 220 NEFVKAAKS 228 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/75 (36%), Positives = 39/75 (52%) Frame = +1 Query: 184 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDAT 363 VL L+ + VI E+++V YAPWC L P +A+AAT L E S + +AK+D Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGD 138 Query: 364 QEQDLXRELRCTRIP 408 + + EL P Sbjct: 139 RYSKIASELEIKGFP 153 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 3/85 (3%) Frame = +1 Query: 163 EVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 333 E+ NV+ LSK E ++ + E LV YAPWC C+++ Y + A KLA + Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLAGKGV 396 Query: 334 PIKLAKVDATQEQDLXRELRCTRIP 408 + + D Q++ +EL+ P Sbjct: 397 KVAKFRADGEQKEFAKQELQLGSFP 421 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 7/107 (6%) Frame = +1 Query: 127 TAIALLGLALGDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYA 300 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 301 KAATKLAEEESP-----IKLAKVDATQEQDLXRELRCTRIPDSQILQ 426 KAA + + P + L VD T+E L + P +I + Sbjct: 182 KAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFR 228 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 3/96 (3%) Frame = +1 Query: 100 NIAMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVISTTEYILVEFYAPWCGH 273 +I RV T IA L L + + ++ L S +E +S + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 274 CKSLAPEYAKAATKLAEEESPIKLAKVDATQ-EQDL 378 C+ LAP+ K + ++ + + L VD T+ EQ+L Sbjct: 153 CRELAPDVYKIEQQYKDKVNFVML-NVDNTKWEQEL 187 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 3/80 (3%) Frame = +1 Query: 178 ENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLA 348 EN++ LS+ E ++ + E +V YAPWC C+++ Y + A KLA + Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLAGSGIKVAKF 412 Query: 349 KVDATQEQDLXRELRCTRIP 408 + D Q++ +EL+ P Sbjct: 413 RADGDQKEFAKQELQLGSFP 432 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%) Frame = +1 Query: 172 TEENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKL 345 T V + K F ++ + ++++ Y WCG CK +AP+Y +L+E+ + Sbjct: 76 TVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKY----KELSEKYQDMVF 131 Query: 346 AKVDATQE-QDLXRELRCTRIPDSQILQGMAVLSTI 450 K+D Q+ + L +EL +P +IL+ V+ + Sbjct: 132 LKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEV 167 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 175 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEYAKAA 309 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 175 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEYAKAA 309 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +1 Query: 175 EENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEYAKAA 309 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 5/83 (6%) Frame = +1 Query: 193 LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP-----IKLAKVD 357 L+ A FE + ++V FYAPWC L P + KA+ E +P + L VD Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQITRERYNPGTDDRVLLGSVD 206 Query: 358 ATQEQDLXRELRCTRIPDSQILQ 426 T+E L + P +I + Sbjct: 207 CTEEPTLCKSNHIQGYPSIRIFR 229 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 41.5 bits (93), Expect = 7e-04 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +1 Query: 145 GLALGDEVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEYAKAATK 315 G A ++ ENV+ LS+ E ++ + E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 316 LAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 L + + D Q+ +EL+ P Sbjct: 395 LGGSGVKVAKFRADGDQKDFAKKELQLGSFP 425 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 199 KANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDL 378 K+ + T + +++EF A WCG CK+L P+ + A K + ++ K+D + Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTD----VEFVKIDVDVLMSV 104 Query: 379 XRELRCTRIP 408 E + +P Sbjct: 105 WMEFNLSTLP 114 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/70 (27%), Positives = 38/70 (54%) Frame = +1 Query: 199 KANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDL 378 K+ F+++ + + ++++F A WCG CK++ P + A+K +E A+VD + D+ Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE----AVFARVDVDRLMDV 88 Query: 379 XRELRCTRIP 408 R +P Sbjct: 89 AGTYRAITLP 98 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 ++V+FYA WCG C +A E A E ES + KVD E + R+++ +P Sbjct: 97 LIVDFYATWCGPCILMAQELEMLA---VEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE-QDLXRELRCTRIPDS 414 ++++ Y WCG CK +AP+Y KA L+E+ + K+D + + L +EL +P Sbjct: 90 VVLDMYTQWCGPCKVIAPKY-KA---LSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTF 145 Query: 415 QILQGMAVLSTI 450 +IL+ V+ + Sbjct: 146 KILKDNKVVKEV 157 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/68 (25%), Positives = 36/68 (52%) Frame = +1 Query: 205 NFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXR 384 +F + + + ++V+F A WCG C+ + P A +A++ + + K+D + D+ + Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEP----AIHAMADKFNDVDFVKLDVDELPDVAK 94 Query: 385 ELRCTRIP 408 E T +P Sbjct: 95 EFNVTAMP 102 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ++V+FY WCG C+++ P+ K A+E I KV+ + + L + L +P Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKT----AKEHPNILFLKVNFDENKSLCKSLNVKVLPYFH 171 Query: 418 ILQG 429 +G Sbjct: 172 FYRG 175 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +3 Query: 483 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFF 584 W ++K GP +++TSAEQ L DA + +++ F+ Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFY 121 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 172 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKL 345 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A + KL Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKL 130 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +1 Query: 193 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 LS + ++T V+ + +LVEF+APWCG C+ + P + A A K K++ + Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFA---GKFKFYKINTDES 147 Query: 370 QDLXRELRCTRIPDSQILQG 429 + +P I +G Sbjct: 148 PNTANRYGIRSVPTVIIFKG 167 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 3/92 (3%) Frame = +1 Query: 163 EVPTEENVLVLSKANF--ETVISTTEYILV-EFYAPWCGHCKSLAPEYAKAATKLAEEES 333 E T N+L + AN +++++ + ++V +FY+P CG CKSL P+ +LAE Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKIC----QLAETNP 135 Query: 334 PIKLAKVDATQEQDLXRELRCTRIPDSQILQG 429 + KV+ + + + L +P + +G Sbjct: 136 NVMFLKVNQEELRTMCHGLNVHVLPFFKFYRG 167 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 2/95 (2%) Frame = +1 Query: 172 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE-ESPIKL 345 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P LA+ IK Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP----LVNDLAQHYTGKIKF 133 Query: 346 AKVDATQEQDLXRELRCTRIPDSQILQGMAVLSTI 450 K++ + + + IP I G TI Sbjct: 134 YKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTI 168 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +1 Query: 214 TVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELR 393 TV+ + + +LVEF A WCG CK + P + + ++ + + K+D L E + Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDK---LTIVKIDHDANPKLIAEFK 138 Query: 394 CTRIP 408 +P Sbjct: 139 VYGLP 143 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ++VEFY WC C++L P+ K A E I KV+ + + + + L +P Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAV----EHPDIVFLKVNFDENKPMCKSLNVRVLPFFH 181 Query: 418 ILQG 429 +G Sbjct: 182 FYRG 185 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ++VEFY WC C++L P+ K A E I KV+ + + + + L +P Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAV----EHPDIVFLKVNFDENKPMCKSLNVRVLPFFH 181 Query: 418 ILQG 429 +G Sbjct: 182 FYRG 185 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 163 EVPTEENVL-VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 339 E T++ +L VL K+ T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 102 EFKTDDELLSVLEKSK-----ETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 156 Query: 340 KLAKVDATQEQDLXREL 390 K + E D E+ Sbjct: 157 IFLKHNVVDEYDEQSEV 173 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 163 EVPTEENVL-VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 339 E T++ +L VL K+ T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 89 EFKTDDELLSVLEKSK-----ETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143 Query: 340 KLAKVDATQEQDLXREL 390 K + E D E+ Sbjct: 144 IFLKHNVVDEYDEQSEV 160 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 163 EVPTEENVL-VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 339 E T++ +L VL K+ T ++V+FY CG CK + ++K + ++E+P+ Sbjct: 89 EFKTDDELLSVLEKSK-----ETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPV 143 Query: 340 KLAKVDATQEQDLXREL 390 K + E D E+ Sbjct: 144 IFLKHNVVDEYDEQSEV 160 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/66 (21%), Positives = 37/66 (56%) Frame = +1 Query: 211 ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXREL 390 + ++++ + +LV++YA WCG C+ + P + + L ++ I++ K+D + + + Sbjct: 75 DLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDK---IQVVKIDTEKYPSIANKY 131 Query: 391 RCTRIP 408 + +P Sbjct: 132 KIEALP 137 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ++V+F A WCG C+ +AP +A A KL + KVD + + + + +P Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKLPN----VLFLKVDTDELKSVASDWAIQAMPTFM 86 Query: 418 ILQGMAVLSTI 450 L+ +L + Sbjct: 87 FLKEGKILDKV 97 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/64 (26%), Positives = 36/64 (56%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ++V+F++P CG CK+L P+ K+AE+ ++ +V+ + + L + L +P + Sbjct: 116 VVVDFFSPSCGGCKALHPKIC----KIAEKNPEVEFLQVNYEEHRSLCQSLNIHVLPFFR 171 Query: 418 ILQG 429 +G Sbjct: 172 FYRG 175 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 35.9 bits (79), Expect = 0.036 Identities = 17/70 (24%), Positives = 33/70 (47%) Frame = +1 Query: 199 KANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDL 378 +A + + +++ F A WCG C+ ++P Y+ AT + S + KVD + D+ Sbjct: 282 EAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLAT----QHSRVVFLKVDIDKANDV 337 Query: 379 XRELRCTRIP 408 + +P Sbjct: 338 AASWNISSVP 347 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 35.5 bits (78), Expect = 0.047 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 I+++F A WC C+ +AP +A+ A K + K+D + Q + +E + +P Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKKFTN----VVFFKIDVDELQAVAQEFKVEAMP 82 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 35.1 bits (77), Expect = 0.062 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 205 NFETVISTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLX 381 +F+ ++ ++ +LV+FYA WCG C+ + P + + L + I + K+D + L Sbjct: 67 SFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETL---KDIIAVVKIDTEKYPSLA 123 Query: 382 RELRCTRIP 408 + + +P Sbjct: 124 NKYQIEALP 132 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +1 Query: 190 VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 369 +L++ NF + I ++L+ PWCG +SL E + + EE +KL V E Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQR-REEFGLLKLMVVYRNSE 87 Query: 370 QDLXREL 390 + L + + Sbjct: 88 KVLAQAI 94 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIP 408 I+++F A WC C+ +AP +A LA++ + KVD + + E + +P Sbjct: 30 IVIDFTATWCPPCRFIAPVFA----DLAKKHLDVVFFKVDVDELNTVAEEFKVQAMP 82 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 32.3 bits (70), Expect = 0.44 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +1 Query: 226 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRI 405 + + I+++F A WC C+ +AP + A K S KVD + Q + +E + Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKKFM---SSAIFFKVDVDELQSVAKEFGVEAM 83 Query: 406 P 408 P Sbjct: 84 P 84 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.9 bits (69), Expect = 0.58 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 184 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVD 357 V+ L+ F I + V+F PWC HCK L + K E + I++ +VD Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLG-KAMEGDDEIEVGEVD 84 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.9 bits (69), Expect = 0.58 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 184 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVD 357 V+ L+ F I + V+F PWC HCK L + K E + I++ +VD Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLG-KAMEGDDEIEVGEVD 84 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.9 bits (69), Expect = 0.58 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 184 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVD 357 V+ L+ F I + V+F PWC HCK L + K E + I++ +VD Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLG-KAMEGDDEIEVGEVD 84 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQD 375 ++ F A WCG CK +AP + +L+E+ S + VD + D Sbjct: 48 VVANFSATWCGPCKIVAPFF----IELSEKHSSLMFLLVDVDELSD 89 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.5 bits (68), Expect = 0.77 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +1 Query: 238 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXRELRCTRIPDSQ 417 ILV + +P CG C++L P K + E + ++D ++Q++ P Q Sbjct: 445 ILVLYTSPTCGPCRTLKPILNKV---VDEYNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQ 501 Query: 418 ILQGMAVLSTIQVV 459 + +L TI V Sbjct: 502 FFKNKEMLRTISGV 515 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.5 bits (68), Expect = 0.77 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 211 ETVISTTEYILVEFYAPWCGHCK 279 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +1 Query: 190 VLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDAT 363 VL K + ++S + IL+ F A WC C++ P+ + ++ E +L + + Sbjct: 348 VLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSD 407 Query: 364 QEQD 375 ++Q+ Sbjct: 408 RDQE 411 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 31.1 bits (67), Expect = 1.0 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 4/89 (4%) Frame = +1 Query: 175 EENVLVLSKANFETVISTT----EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIK 342 ++N+ +S A E V S T + ++V+F++P CG CK+L P+ + AE ++ Sbjct: 96 KDNMREISSAQ-ELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKIC----QFAEMNPDVQ 150 Query: 343 LAKVDATQEQDLXRELRCTRIPDSQILQG 429 +V+ + + + L +P + +G Sbjct: 151 FLQVNYEEHKSMCYSLGVHVLPFFRFYRG 179 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 223 STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 327 S T +++V F A WCG C+ + P K ++ E Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +1 Query: 211 ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLXREL 390 + + S+ ++ + A WCG C + P A KL+ S +K D + + R + Sbjct: 37 DDIKSSKSPAVINYGASWCGVCSQILP----AFRKLSNSFSKLKFVYADIDECPETTRHI 92 Query: 391 RCT 399 R T Sbjct: 93 RYT 95 >At4g30160.1 68417.m04289 villin, putative similar to villin 2 (VLN2) [Arabidopsis thaliana] GI:3415115, villin 3 (VLN3) [Arabidopsis thaliana] GI:3415117; contains Pfam profiles PF00626: Gelsolin repeat, PF02209: Villin headpiece domain Length = 974 Score = 28.7 bits (61), Expect = 5.4 Identities = 18/71 (25%), Positives = 31/71 (43%) Frame = +3 Query: 402 DTRLSNSSGNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGF 581 DT+ NGS +A +++ ++K EV + E K + DA++ +GF Sbjct: 171 DTKSKIFQFNGSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGF 230 Query: 582 FSDQSSARAKT 614 F + KT Sbjct: 231 FGGFAPLPRKT 241 >At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein similar to SP|P09379 GTPase-activating protein GYP7 (Fragment) {Yarrowia lipolytica}; contains Pfam profile PF00566: TBC domain Length = 424 Score = 27.9 bits (59), Expect = 9.5 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 247 EFYAPWCGHCKSLAPEYA--KAATK--LAEEESPIKLAKVDATQEQDLXRELRCTRIPDS 414 E Y W CK++ P K T +AE+ P++ + VD QE + T I D Sbjct: 105 EQYYAWKEECKNMVPLVGSGKFVTMAVVAEDGQPLEESSVD-NQEWVVK-----TAITDK 158 Query: 415 QILQGMAVLSTI 450 ++LQ M VLS I Sbjct: 159 RVLQWMLVLSQI 170 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 553 SISSLACSADVTSTAGGPVFFFSQLMMSSA*RPP 452 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At3g55605.1 68416.m06176 mitochondrial glycoprotein family protein / MAM33 family protein low similarity to SUAPRGA1 [Emericella nidulans] GI:6562379; contains Pfam profile PF02330: Mitochondrial glycoprotein Length = 258 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 328 ESPIKLAKVDATQEQDLXRELRCTRIPDSQILQGMAV 438 ES I L V T++ L E CT PD ++ G++V Sbjct: 152 ESSIPLV-VTVTKKSGLSLEFSCTAFPDEIVIDGLSV 187 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,904,183 Number of Sequences: 28952 Number of extensions: 274905 Number of successful extensions: 857 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -