BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A17 (944 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13710.1 68414.m01611 cytochrome P450 family protein similar ... 32 0.64 At4g29100.1 68417.m04165 ethylene-responsive family protein cont... 29 4.5 At5g06900.1 68418.m00779 cytochrome P450 family protein 29 5.9 >At1g13710.1 68414.m01611 cytochrome P450 family protein similar to cytochrome P450 78A1 (SP:P48420) GI:349717 from [Zea mays] Length = 517 Score = 31.9 bits (69), Expect = 0.64 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 7/70 (10%) Frame = +3 Query: 234 DLLSNRFGEDEEAPIEVRGDGNLINRLNSLPIE-------NQPFWYLNWKAYEALRKRPQ 392 ++++ FGE + EV G G + RL S E + FW+L W ++ +RKR + Sbjct: 200 NVMTTVFGESYDFD-EVNGKGCFLERLVSEGYELLGIFNWSDHFWFLRWFDFQGVRKRCR 258 Query: 393 TFQQRPNNFI 422 N F+ Sbjct: 259 ALVSEVNTFV 268 >At4g29100.1 68417.m04165 ethylene-responsive family protein contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 407 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -2 Query: 298 LPSPRTSMGASSSSPNLFDSKSVST 224 LPSP TS +SSSSP+L ++ ++S+ Sbjct: 67 LPSPATSSSSSSSSPSLPNNPNLSS 91 >At5g06900.1 68418.m00779 cytochrome P450 family protein Length = 507 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/85 (24%), Positives = 42/85 (49%) Frame = +3 Query: 303 INRLNSLPIENQPFWYLNWKAYEALRKRPQTFQQRPNNFIDRN**RQKKNTSIENHETVA 482 +N L ++ FW+L + L+KR + + + + I+R ++ +S +N A Sbjct: 213 LNELAGFFNVSETFWFLKRLDLQGLKKRLKNARDKYDVIIERI--MEEHESSKKN----A 266 Query: 483 TNSSTVLDVRISIFFFRNGKLDLIR 557 T +LDV + I+ +N ++ L R Sbjct: 267 TGERNMLDVLLDIYEDKNAEMKLTR 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,625,015 Number of Sequences: 28952 Number of extensions: 326709 Number of successful extensions: 797 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2266029384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -