BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A13 (884 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.2 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 3.2 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 3.2 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 9.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 478 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 377 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 478 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 377 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 478 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 377 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 478 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 377 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 584 FLYKRSNIIPEFYPYSEEKP 643 F YK NI PYS EKP Sbjct: 16 FFYKICNIFGIVPPYSFEKP 35 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 584 FLYKRSNIIPEFYPYSEEKP 643 F YK NI PYS EKP Sbjct: 16 FFYKICNIFGIVPPYSFEKP 35 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 143 RDPATDQLINYKKTLKDSPGFIT-TKSGAPVGI 238 + P++ ++ + T SPGF+T TK+ V + Sbjct: 65 KSPSSPRISSPSSTKSGSPGFLTYTKADRDVDL 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,659 Number of Sequences: 336 Number of extensions: 4458 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -