BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A12 (1062 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.5 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 6.1 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 8.1 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 3.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 447 WRSHWPSLDDHRNWY 403 W +H P+ D NWY Sbjct: 661 WLNHSPNYDQVTNWY 675 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 6.1 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = +2 Query: 92 IPRCCYPAALLXMRERSSFYASWLR------REVSDHQ 187 +P CC + R S Y+S LR R+ DHQ Sbjct: 363 LPNCCGKWSSQKSEPRRSIYSSLLRYPRSIFRQTDDHQ 400 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 8.1 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -2 Query: 179 RILLCVTRRHRNLSVHAXQGVQRDNNTLEYILNCDRFRCSGQEC 48 RI + RHRNL + V+ N L I R EC Sbjct: 220 RISCVIASRHRNLEATESENVRPRRNVL--IERAKSIRARRTEC 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,233 Number of Sequences: 438 Number of extensions: 5164 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 59 effective length of database: 120,501 effective search space used: 35427294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -