BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A12 (1062 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32350.1 68417.m04605 expressed protein contains Pfam profile... 32 0.56 At1g75140.1 68414.m08728 expressed protein 31 1.3 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 29 3.9 At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein ... 28 9.1 At3g51290.1 68416.m05614 proline-rich family protein 28 9.1 At3g43583.1 68416.m04636 hypothetical protein 28 9.1 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 28 9.1 >At4g32350.1 68417.m04605 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 732 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 134 ERSSFYASWLRREVSD-HQPIFKVSPTPSRYSRLCHLGQGNGGREGLRD 277 ER FY + + HQPIF T +LGQGNG R G+ D Sbjct: 279 ERKEFYLHSKQNPAREKHQPIFNEGDTIVMKVNYGNLGQGNGHRPGVVD 327 >At1g75140.1 68414.m08728 expressed protein Length = 617 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +2 Query: 95 PRCCYPAALLXMRERSSFYASWLRREVSDHQPIFKVSP-TPSRYSRLCHLGQGNG 256 PR +PAAL +R S+F + + +DHQ + KV+P S +L +G G+G Sbjct: 402 PRLLFPAALEDIR--STFLSHRESTKTTDHQKLEKVTPLIASDREKLLVMGLGDG 454 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 829 HRXPXXHXXXPXXXPSPXPXPXPXPPPXXXXXXP 930 H P H P P P P P P PPP P Sbjct: 42 HHPPPPHFSPPHQPP-PSPYPHPHPPPPSPYPHP 74 >At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 262 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 246 REMGGGKVFGTLGESDQGLFGKGGY 320 REMGGG +DQG FG GY Sbjct: 23 REMGGGDSLEAGTSTDQGAFGSLGY 47 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.3 bits (60), Expect = 9.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 847 HXXXPXXXPSPXPXPXPXPPP 909 H P P P P P P PPP Sbjct: 65 HHNPPSPSPPPPPPPRPPPPP 85 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 28.3 bits (60), Expect = 9.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 859 PXXXPSPXPXPXPXPPP 909 P PSP P P P PPP Sbjct: 23 PEKPPSPEPPPSPEPPP 39 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 28.3 bits (60), Expect = 9.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 859 PXXXPSPXPXPXPXPPP 909 P PSP P P P PPP Sbjct: 28 PSPCPSPPPKPQPKPPP 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,669,835 Number of Sequences: 28952 Number of extensions: 364697 Number of successful extensions: 1735 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1531 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2627750416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -