BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A11 (1018 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 0.93 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 31 1.2 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 4.9 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 8.6 At1g26150.1 68414.m03192 protein kinase family protein similar t... 28 8.6 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 672 PXKXXPPPPLIXXXPPPXXDXXXXXLQPRXXXGPXXXXPPXSPXGP 809 P PPPP+ PPP P P PP +P P Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/68 (27%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = +3 Query: 672 PXKXXPPPPLIXXXPPPXXDXXXXXLQPRXXXGPXXXXPP-XSPXGPAXGXFXXLLXTXF 848 P PPPP+ PPP P P PP SP P+ + + Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498 Query: 849 XNPXPXPP 872 P P PP Sbjct: 499 PPPPPPPP 506 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/56 (28%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 642 GGGNXXXGXXPXKXXPPPPLIXXXP---PPXXDXXXXXLQPRXXXGPXXXXPPXSP 800 GGG G P PPP ++ P PP ++P P PP P Sbjct: 79 GGGGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQP 134 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +3 Query: 687 PPPPLIXXXPPPXXDXXXXXLQPRXXXGPXXXXPPXSPXGP 809 PPPP++ PPP P+ P SP P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAP 128 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 672 PXKXXPPPPLIXXXPPPXXDXXXXXLQPRXXXGPXXXXPPXSP 800 P + PPPPL PPP + P PP +P Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,180,521 Number of Sequences: 28952 Number of extensions: 156638 Number of successful extensions: 1043 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2499440136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -