BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A08 (955 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 29 0.070 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 23 2.6 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 28.7 bits (61), Expect = 0.070 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 6/62 (9%) Frame = +1 Query: 442 IHADKNILRS---GALKKMKYLQVIIMNYNEITTVX-DVFX--PELXTLEVGYNTIXXXN 603 IH D N + S A +K L+ + + N+I T+ + F PEL L++ YN+I + Sbjct: 121 IHLDDNRIESLERRAFMNLKSLKRLNLKGNKIATIAYETFQNLPELEDLDLAYNSISSLD 180 Query: 604 FD 609 F+ Sbjct: 181 FN 182 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 340 LLCRSDSCPCRSLLNXXTHXLPQ 272 LLC D PC +L N LP+ Sbjct: 36 LLCALDKAPCDALGNQIKGALPE 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,195 Number of Sequences: 336 Number of extensions: 2523 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26892580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -