SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_A05
         (1023 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    24   1.9  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   7.8  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   7.8  

>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 24.2 bits (50), Expect = 1.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 585 HHPHPPXXP 611
           HHPHPP  P
Sbjct: 465 HHPHPPETP 473


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.2 bits (45), Expect = 7.8
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +2

Query: 275  CILRGPSPRPTLLQA 319
            C+LR  +P P +L+A
Sbjct: 1106 CVLRASTPAPVVLEA 1120


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 7.8
 Identities = 13/45 (28%), Positives = 17/45 (37%)
 Frame = +1

Query: 196 LTTARTSLILPKTTTLMETATNLSTTVHITWTLPKADLTSSLPLS 330
           +TT  T+     TTT   T  N +     T   P+ D      LS
Sbjct: 658 ITTITTTTTTTTTTTTTTTTPNTTQNASATTPPPQVDEVDDKELS 702


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 207,470
Number of Sequences: 438
Number of extensions: 4863
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 34104798
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -