BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A02 (912 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor ... 32 2.5 M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta ... 32 2.5 BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, be... 32 2.5 BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, be... 32 2.5 AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, be... 32 2.5 AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, be... 32 2.5 AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, b... 32 2.5 AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, b... 32 2.5 AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, be... 32 2.5 AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, be... 32 2.5 AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, b... 32 2.5 AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, b... 32 2.5 AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor bet... 32 2.5 AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B p... 32 2.5 AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, be... 32 2.5 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 32 3.3 X52541-1|CAA36777.1| 543|Homo sapiens protein ( Human mRNA for ... 31 5.8 M62829-1|AAA35815.1| 543|Homo sapiens ETR103 protein. 31 5.8 BC073983-1|AAH73983.1| 543|Homo sapiens early growth response 1... 31 5.8 AJ243425-1|CAB46678.1| 543|Homo sapiens early growth response p... 31 5.8 >X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor b protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPTLGGSGAPPPPPMPPPP 128 >BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, beta protein. Length = 482 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 36 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 77 >AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B protein. Length = 533 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 87 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 128 >AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, beta variant protein. Length = 577 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 346 SXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 S NPLP PPP P P P + + PPP + P P Sbjct: 127 SPNPLPQ-GVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPP 168 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 31.9 bits (69), Expect = 3.3 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +1 Query: 322 PINXGGPCSXNPLPF*XXPPPRSPXPAXXPFSPXXXSXAXFPPPTGVXPXP 474 P++ G P P P PPP S P P P + P P G P P Sbjct: 321 PVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAP 371 >X52541-1|CAA36777.1| 543|Homo sapiens protein ( Human mRNA for early growth response protein 1 (hEGR1). ). Length = 543 Score = 31.1 bits (67), Expect = 5.8 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 152 GGFLNPLLPGWLFGRRTLDSGRXTPKKKHXKGPCSET 262 GGF P++P +LF ++ D G TP +K +G S T Sbjct: 245 GGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRT 281 >M62829-1|AAA35815.1| 543|Homo sapiens ETR103 protein. Length = 543 Score = 31.1 bits (67), Expect = 5.8 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 152 GGFLNPLLPGWLFGRRTLDSGRXTPKKKHXKGPCSET 262 GGF P++P +LF ++ D G TP +K +G S T Sbjct: 245 GGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRT 281 >BC073983-1|AAH73983.1| 543|Homo sapiens early growth response 1 protein. Length = 543 Score = 31.1 bits (67), Expect = 5.8 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 152 GGFLNPLLPGWLFGRRTLDSGRXTPKKKHXKGPCSET 262 GGF P++P +LF ++ D G TP +K +G S T Sbjct: 245 GGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRT 281 >AJ243425-1|CAB46678.1| 543|Homo sapiens early growth response protein 1 protein. Length = 543 Score = 31.1 bits (67), Expect = 5.8 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 152 GGFLNPLLPGWLFGRRTLDSGRXTPKKKHXKGPCSET 262 GGF P++P +LF ++ D G TP +K +G S T Sbjct: 245 GGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRT 281 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,472,760 Number of Sequences: 237096 Number of extensions: 1305257 Number of successful extensions: 4568 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 2510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4111 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11825849886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -