BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_A01 (934 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 24 1.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 4.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 4.5 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 24.2 bits (50), Expect = 1.5 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = +2 Query: 188 RRDAPDFFKDIEH-----HTKEFHKT--LEQQFNSLTKS 283 RR AP F+DI+H + +E +T L + F SL KS Sbjct: 84 RRKAPQSFEDIQHQRVMANVRERQRTQSLNEAFASLRKS 122 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 291 ASFDLVSELNCCSKVLWNSLV 229 A D SE++C S+ +W+ L+ Sbjct: 102 ALLDTGSEVSCISEEVWSKLI 122 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 4.5 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 515 AAVQNTVQESQKLXKKVSSNVXETNEKLAPKIKPP 619 A V+ +VQE +K + + N ++ K++PP Sbjct: 488 APVKISVQEVLNRVRKPTKKLHLKNSPISKKVRPP 522 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,793 Number of Sequences: 336 Number of extensions: 1794 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26168549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -