Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0008_F13
         (537 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc fi...    22   4.6  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    21   8.0  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    21   8.0  

>AB208108-1|BAE72140.1|   92|Apis mellifera Broad complex zinc
           finger domain-Z3 isoform protein.
          Length = 92

 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 443 PQECPYRKR 417
           PQECPY +R
Sbjct: 5   PQECPYCRR 13


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.0 bits (42), Expect = 8.0
 Identities = 11/42 (26%), Positives = 21/42 (50%)
 Frame = -3

Query: 436 NAHTASA*ITQTEYALTVRHHYSSHISFRPVLQDIVNVSLVV 311
           N  + S+   + +Y     +HY+SH   R  L+  + V++ V
Sbjct: 102 NRSSTSSNDPKNQYKNQNNNHYTSHQHLRTHLRGTLTVNVSV 143


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.0 bits (42), Expect = 8.0
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +2

Query: 314 DKGHVYDVLKNW 349
           D+   YDVL++W
Sbjct: 260 DQSETYDVLRSW 271


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,955
Number of Sequences: 438
Number of extensions: 3754
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15213684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)