Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0008_C10
         (511 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    25   0.45 
DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor pro...    21   9.8  
DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor pro...    21   9.8  
AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    21   9.8  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 25.0 bits (52), Expect = 0.45
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = -3

Query: 332 IKNNLLKDVIVTDLPMELRESFENICERINREIKW 228
           + N L +  +  D+  +LRE     C + N+E+K+
Sbjct: 313 MSNALYELALNQDVQKKLREEINTFCPKNNKELKY 347


>DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -2

Query: 477 VCWYIFFLM 451
           VCW  FFLM
Sbjct: 338 VCWLPFFLM 346


>DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -2

Query: 477 VCWYIFFLM 451
           VCW  FFLM
Sbjct: 338 VCWLPFFLM 346


>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
           receptor protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -2

Query: 477 VCWYIFFLM 451
           VCW  FFLM
Sbjct: 338 VCWLPFFLM 346


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,693
Number of Sequences: 438
Number of extensions: 2453
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14109465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)