Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0007_N23
         (481 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit Ss...    25   4.5  
SPAPYUG7.03c |mid2||anillin homologue Mid2|Schizosaccharomyces p...    25   7.8  

>SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit
           Ssl1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 421

 Score = 25.4 bits (53), Expect = 4.5
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = -1

Query: 319 CAGES*LQSCTYFSDAGLLYLSLAKSRRIFVIFGQI 212
           C+G   LQ+    + A L +++   +R + +IFG I
Sbjct: 165 CSGNFSLQNALEMARASLSHIASHGTREVLIIFGSI 200


>SPAPYUG7.03c |mid2||anillin homologue Mid2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 704

 Score = 24.6 bits (51), Expect = 7.8
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 350 QIPWNFLHSVT 382
           Q+PWN LHS T
Sbjct: 421 QVPWNALHSTT 431


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,825,334
Number of Sequences: 5004
Number of extensions: 34241
Number of successful extensions: 58
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 184020746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)