BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0007_E06
(697 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila F... 36 0.10
>X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila Fat
protein protein.
Length = 4590
Score = 36.3 bits (80), Expect = 0.10
Identities = 16/50 (32%), Positives = 31/50 (62%)
Frame = -1
Query: 304 GESXIVVLRSQEDLDNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSL 155
G S ++ +R+ D D+G +G + ++D + V+ES+ N+E W+T+L
Sbjct: 2826 GGSRVIQIRAS-DADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL 2874
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,465,097
Number of Sequences: 237096
Number of extensions: 2062012
Number of successful extensions: 15441
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15317
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15441
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8007229802
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -