Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0007_D12
         (451 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              21   8.2  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    21   8.2  

>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 223 CEYKYRF*KLF 191
           CEY YRF K +
Sbjct: 124 CEYAYRFNKCY 134


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 10/38 (26%), Positives = 17/38 (44%)
 Frame = -1

Query: 328 LLIFIYLLMHASSLFFLIETI*SLVLXXXXXNYK*CEY 215
           L + I +L+H   + F+ + I S         Y  C+Y
Sbjct: 11  LFVIINVLLHGQVICFVCKDITSTSALYRLKLYLFCDY 48


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,893
Number of Sequences: 438
Number of extensions: 1798
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)