BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_B14 (520 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.02 |hop1||linear element associated protein Hop1|Schizo... 27 1.3 SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyce... 25 5.1 SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyce... 25 6.8 >SPBC1718.02 |hop1||linear element associated protein Hop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 528 Score = 27.5 bits (58), Expect = 1.3 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -3 Query: 152 RTFIIASESRRLPLQRYLVQLEPATSLLEVFVIRPKLFHLAMNTG 18 +T+I + S ++P YL+ S+LE + ++F +N G Sbjct: 82 KTYIFSLVSMKVPFTVYLIISSQCKSILEDDAVEKEIFSFTINPG 126 >SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 324 Score = 25.4 bits (53), Expect = 5.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 483 FYTLYQWFHILSLLDPLCGFCNKCM 409 F + +QWFH+ ++ C F C+ Sbjct: 286 FGSSHQWFHVCVIIAAFCHFHGVCI 310 >SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 506 Score = 25.0 bits (52), Expect = 6.8 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +3 Query: 357 VYHGEGLVEDVNCNEPYPYICYRNHTKD 440 V+ + +V ++ ++ YPY+ + H KD Sbjct: 424 VFMIQEVVSQISASDGYPYVAWVEHCKD 451 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,244,210 Number of Sequences: 5004 Number of extensions: 45710 Number of successful extensions: 98 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -