BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_B06 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0002 - 13567257-13567373,13568049-13568243,13569750-135698... 30 1.4 03_06_0727 - 35766252-35766481,35766592-35766721,35767049-357671... 30 1.9 05_01_0383 + 2990812-2990855,2991364-2991463,2991554-2991622,299... 29 3.3 05_06_0001 + 24769633-24770148 29 4.4 03_06_0047 + 31266940-31268394 29 4.4 >09_04_0002 - 13567257-13567373,13568049-13568243,13569750-13569869, 13569958-13570028,13570066-13570126,13570170-13570202, 13570303-13570431,13571958-13572042,13572143-13572252, 13572534-13572606,13572688-13572810,13573111-13573289, 13573659-13573736,13573813-13573871,13574122-13574212, 13574265-13574442,13574553-13575088 Length = 745 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 666 HRLRHRLAPISGHAQDGALLLFNDNNLIGFRLVFH 562 + L HR+A ++ +QD F+DN L+ F LV+H Sbjct: 606 YSLEHRVALVA-FSQDDCYTTFDDNPLVDFFLVYH 639 >03_06_0727 - 35766252-35766481,35766592-35766721,35767049-35767116, 35767179-35767217,35767677-35767761,35768097-35768197, 35768292-35768511 Length = 290 Score = 29.9 bits (64), Expect = 1.9 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 9/103 (8%) Frame = +1 Query: 250 EADPCVCTFIYAPVCGTDGNTYPNKCSLECS-RP*APSL-------KMNLRGNCQEVKVA 405 + D V +Y P GT P K S+E +P + +M L+ Q + + Sbjct: 35 QGDTIVLAAVYGPKPGTRKGENPEKASIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLL 94 Query: 406 DIQPCICTREIKQVCGSDG-VTYGNPCLLNCATQSNPSLSIEH 531 + P T I QV G+DG V++ LL+ S L EH Sbjct: 95 TVHPNTTTSVILQVVGNDGSVSFCRNVLLSIV--SGCLLDYEH 135 >05_01_0383 + 2990812-2990855,2991364-2991463,2991554-2991622, 2991724-2991960,2992045-2992228,2992307-2992442, 2992529-2992691,2992958-2993108,2993154-2993278, 2993349-2993504,2993792-2993860,2993951-2994019, 2994127-2994264,2994626-2994773,2994856-2994866, 2995212-2995352,2995441-2995569,2995860-2995899, 2996020-2996348,2996902-2996919 Length = 818 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +3 Query: 54 YTRYISDRRCAN--IRRNSAAVVMRVRKKLKTGLRIRRQDLPQPVPLVLREGQDAQRF 221 Y ++S R AN ++N A+ RV+ +R + DLP L++REG + RF Sbjct: 508 YKNFVSQRSDANGWYQKNGVAL-FRVQGLKHDCIRAIQVDLPLKQSLLVREGSEPDRF 564 >05_06_0001 + 24769633-24770148 Length = 171 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 375 SGQLPGS*SCRYTAMYLHAGDQTGLR*RRRHLRQPVPVELRH 500 SG P S CR A L + LR R R L PVE RH Sbjct: 9 SGSPPSSLECRLAAPSLPSASSRRLRRRPRLLAARRPVERRH 50 >03_06_0047 + 31266940-31268394 Length = 484 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 130 RNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 276 R + C D TY ++CE DK LK+ K ++ P + TF Sbjct: 368 RRMIKCCQPDCDTYTMMIKMFCENDKVEMALKVWKYMRLKQFLPSMHTF 416 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,892,464 Number of Sequences: 37544 Number of extensions: 457398 Number of successful extensions: 1295 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -