BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_B04 (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 25 0.62 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 1.9 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 7.7 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 7.7 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 24.6 bits (51), Expect = 0.62 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 429 GYYSKQWDRSMPT*RLNQQRTKLSRPFTKF 518 G + WD MP ++ T+LSR TK+ Sbjct: 176 GAFGWSWDEVMPYYLKSENNTELSRVGTKY 205 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 161 RHWRLPRFVAIV*GFP 114 RHW+ P V ++ FP Sbjct: 863 RHWKFPNLVEVLDEFP 878 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 359 TNLLGHVSSGTWPSIH*TDLRNIRIL 436 TNL G SSGT + D+ ++ IL Sbjct: 725 TNLSGDSSSGTTLLLELDDIASMEIL 750 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -3 Query: 516 IW*MALRALYAADLTFKSASICPTVC 439 IW + + D+TF I PT C Sbjct: 124 IWVPDISVYNSGDMTFDQTGIPPTTC 149 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = -3 Query: 348 YSAIKFSCSLSRWSSNTLTRNIERLS**HLQQRCPACQGHQT 223 Y + C+L + + R ++ L+ L+ CP C +T Sbjct: 47 YLRRQLKCALGEAPCDPVGRRLKSLAPLVLRGACPQCSPEET 88 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = -3 Query: 348 YSAIKFSCSLSRWSSNTLTRNIERLS**HLQQRCPACQGHQT 223 Y + C+L + + R ++ L+ L+ CP C +T Sbjct: 47 YLRRQLKCALGEAPCDPVGRRLKSLAPLVLRGACPQCSPEET 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,558 Number of Sequences: 438 Number of extensions: 4349 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -