BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A16 (638 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X78549-1|CAA55295.1| 451|Homo sapiens tyrosine kinase protein. 31 2.6 U61412-1|AAC34935.1| 451|Homo sapiens non-receptor type protein... 31 2.6 BC035843-1|AAH35843.1| 451|Homo sapiens PTK6 protein tyrosine k... 31 2.6 AL121829-13|CAC15525.1| 451|Homo sapiens PTK6 protein. 31 2.6 >X78549-1|CAA55295.1| 451|Homo sapiens tyrosine kinase protein. Length = 451 Score = 31.5 bits (68), Expect = 2.6 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 Query: 10 RLYL*CRVCSADGWKVLGDAERPERHIQRCITLGANTLKDPAPELWPTPSAVIVKIVSRH 189 RL CR + D ERP C LG+ + LW V +K++SR Sbjct: 165 RLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRD 224 Query: 190 QKLH 201 LH Sbjct: 225 NLLH 228 >U61412-1|AAC34935.1| 451|Homo sapiens non-receptor type protein tyrosine kinase protein. Length = 451 Score = 31.5 bits (68), Expect = 2.6 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 Query: 10 RLYL*CRVCSADGWKVLGDAERPERHIQRCITLGANTLKDPAPELWPTPSAVIVKIVSRH 189 RL CR + D ERP C LG+ + LW V +K++SR Sbjct: 165 RLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRD 224 Query: 190 QKLH 201 LH Sbjct: 225 NLLH 228 >BC035843-1|AAH35843.1| 451|Homo sapiens PTK6 protein tyrosine kinase 6 protein. Length = 451 Score = 31.5 bits (68), Expect = 2.6 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 Query: 10 RLYL*CRVCSADGWKVLGDAERPERHIQRCITLGANTLKDPAPELWPTPSAVIVKIVSRH 189 RL CR + D ERP C LG+ + LW V +K++SR Sbjct: 165 RLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRD 224 Query: 190 QKLH 201 LH Sbjct: 225 NLLH 228 >AL121829-13|CAC15525.1| 451|Homo sapiens PTK6 protein. Length = 451 Score = 31.5 bits (68), Expect = 2.6 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 Query: 10 RLYL*CRVCSADGWKVLGDAERPERHIQRCITLGANTLKDPAPELWPTPSAVIVKIVSRH 189 RL CR + D ERP C LG+ + LW V +K++SR Sbjct: 165 RLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRD 224 Query: 190 QKLH 201 LH Sbjct: 225 NLLH 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,611,230 Number of Sequences: 237096 Number of extensions: 1759336 Number of successful extensions: 3757 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3757 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7028963750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -