BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A12 (274 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0998 - 23411422-23411649,23411897-23412625 29 0.51 03_05_0424 + 24107009-24107138,24107381-24107784 29 0.67 02_03_0151 - 15759254-15760459 28 0.89 03_01_0585 - 4331111-4331850,4331960-4332224 27 1.5 05_04_0335 - 20354678-20354686,20354819-20355662,20355739-20356217 27 2.7 08_01_0541 + 4702930-4703328,4703411-4703506,4703601-4703649,470... 26 3.6 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 26 3.6 06_03_0246 + 18672704-18673111,18674069-18674164,18674362-186745... 26 4.7 02_05_0704 - 31064996-31065214,31065306-31065466,31065583-310656... 26 4.7 10_08_0267 - 16333239-16333820,16333904-16334842,16334920-163351... 25 6.3 09_03_0035 - 11765108-11765376,11765909-11766005,11766505-117665... 25 6.3 07_01_0649 - 4882418-4883062 25 6.3 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 25 6.3 03_05_0296 + 22866280-22866282,22867178-22867444,22868363-22868869 25 6.3 03_05_0293 + 22849103-22849513,22849670-22849756,22850156-228502... 25 6.3 02_05_0969 + 33165396-33165935,33166352-33166883,33166988-331672... 25 6.3 02_05_0602 + 30283893-30284170,30286259-30286305,30286534-302875... 25 6.3 08_02_1100 + 24303920-24304001,24304080-24304576,24304745-243048... 25 8.3 >08_02_0998 - 23411422-23411649,23411897-23412625 Length = 318 Score = 29.1 bits (62), Expect = 0.51 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 25 STVEGHHGRTGLRAYRRSTRSRHARSIPLLRRLPTLEVLTP 147 STVE LR R + R +PLLRRLP L + P Sbjct: 21 STVEEATDDLVLRDGRVAVRLEEVERVPLLRRLPYLRLAAP 61 >03_05_0424 + 24107009-24107138,24107381-24107784 Length = 177 Score = 28.7 bits (61), Expect = 0.67 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 105 NRPRMTTTCTPSIRPKTSP 49 +RP TTT TPS RP +SP Sbjct: 131 SRPPETTTATPSSRPASSP 149 >02_03_0151 - 15759254-15760459 Length = 401 Score = 28.3 bits (60), Expect = 0.89 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +1 Query: 61 RAYRRSTRSRHARSIPLLRRLPTLEVLTPGSGDETSRSTYTDCYERGRW 207 R +RR+ R H R R LP L G+ RST+ G W Sbjct: 37 REWRRAAREAHQRHRRRRRHLPCLVAHVHGAAAGVGRSTHVYDPRAGAW 85 >03_01_0585 - 4331111-4331850,4331960-4332224 Length = 334 Score = 27.5 bits (58), Expect = 1.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 31 VEGHHGRTGLRAYRRSTRSRHARSI 105 V GH GR RA + R RH R I Sbjct: 90 VAGHDGRAAARAASKKKRGRHFRGI 114 >05_04_0335 - 20354678-20354686,20354819-20355662,20355739-20356217 Length = 443 Score = 26.6 bits (56), Expect = 2.7 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 85 SRHARSIPLLRRLPTLEVLTPGSGDETSRSTYTDCY 192 S RS+ L R+L V++P SGD+ +S+ D Y Sbjct: 21 SARLRSLRLGRQLHEHFVVSPYSGDDVVKSSLVDMY 56 >08_01_0541 + 4702930-4703328,4703411-4703506,4703601-4703649, 4703771-4703865 Length = 212 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 102 RPRMTTTCTPSIRPKTSPSVVSFYS 28 +PR T P +PKT PS S S Sbjct: 14 KPRATARAKPKPKPKTKPSPASLLS 38 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 26.2 bits (55), Expect = 3.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 73 RSTRSRHARSIPLLRRLPTLEVLTPGSGDETSR 171 RST S+HAR+ R + LEVL G G +S+ Sbjct: 308 RSTISQHARAQNHFRSIGGLEVLLDGLGLPSSK 340 >06_03_0246 + 18672704-18673111,18674069-18674164,18674362-18674571, 18675780-18675851,18675898-18675945 Length = 277 Score = 25.8 bits (54), Expect = 4.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 166 KFHHPNRESALPKWVTFVIVESTSHDDYVYS 74 KFHHPN S KW + S +YS Sbjct: 189 KFHHPNSGSGHEKWDGSLQTNQISSGVNIYS 219 >02_05_0704 - 31064996-31065214,31065306-31065466,31065583-31065660, 31066560-31066651,31066775-31066833,31066924-31067010, 31067118-31067214,31067311-31067495,31067593-31067665, 31067725-31067805,31067948-31068048,31068133-31068246, 31068391-31068488,31069789-31069915 Length = 523 Score = 25.8 bits (54), Expect = 4.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 37 GHHGRTGLRAYRRSTRSRHARSIP 108 GHH R+YR TRS S+P Sbjct: 490 GHHWWDKFRSYRTDTRSEEFYSLP 513 >10_08_0267 - 16333239-16333820,16333904-16334842,16334920-16335172, 16336837-16337063,16338189-16339388 Length = 1066 Score = 25.4 bits (53), Expect = 6.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 34 EGHHGRTGLRAYRRSTRSRHARSIPLLR 117 E +GR R RR HARSIP +R Sbjct: 410 EKEYGRRCQRRRRRRRLPEHARSIPQVR 437 >09_03_0035 - 11765108-11765376,11765909-11766005,11766505-11766579, 11767367-11767650,11768466-11768562 Length = 273 Score = 25.4 bits (53), Expect = 6.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 169 RSTYTDCYERGRWIEFQL*DWRLDDC*GPY 258 R+ Y +C+ R +F W DDC G + Sbjct: 90 RAAYHECFNRWYAEKFAKGQWHKDDCVGEW 119 >07_01_0649 - 4882418-4883062 Length = 214 Score = 25.4 bits (53), Expect = 6.3 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 58 LRAYRRSTRSRHARSIPLLRRLP-TLEVLTP 147 L A RR+ R ++ + LLR+LP ++ LTP Sbjct: 180 LEASRRARRMKYKKKARLLRKLPLEVDPLTP 210 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 25.4 bits (53), Expect = 6.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 106 PLLRRLPTLEVLTPGSGDETSRSTYTD 186 P LR LP L + P SG+ SRS+ +D Sbjct: 305 PELRPLPPLPRVGPPSGEFASRSSASD 331 >03_05_0296 + 22866280-22866282,22867178-22867444,22868363-22868869 Length = 258 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 133 EVLTPGSGDETSRSTYTDC-YERGRWIE 213 E+L PGS D T+R + Y +G W E Sbjct: 23 EILPPGSVDHTTRLVLGNALYFKGAWTE 50 >03_05_0293 + 22849103-22849513,22849670-22849756,22850156-22850284, 22850507-22851262,22853474-22854250 Length = 719 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 133 EVLTPGSGDETSRSTYTDC-YERGRWIE 213 E+L PGS D T+R + Y +G W E Sbjct: 231 EILPPGSVDHTTRLVLGNALYFKGAWTE 258 >02_05_0969 + 33165396-33165935,33166352-33166883,33166988-33167242, 33167515-33167606,33167745-33167942,33168049-33168240, 33168341-33168562,33168858-33169024,33169117-33169210, 33169308-33169364,33169459-33169587,33169681-33169752, 33170180-33170293,33170419-33170580,33170666-33170794, 33171057-33171158,33171266-33171342,33171470-33171592, 33171666-33172227 Length = 1272 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 1 EEIPNFPVSTVEGHHGRTGLRAYRRSTRSRHA 96 E+ N P S RTG +A RSTR R A Sbjct: 1062 EDDSNGPFSAQHTVASRTGTKASTRSTRKRQA 1093 >02_05_0602 + 30283893-30284170,30286259-30286305,30286534-30287510, 30287611-30287920,30288561-30290197 Length = 1082 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 49 RTGLRAYRRSTRSRHARSIPLLRRLP 126 R+ RA R + RHA ++ LL RLP Sbjct: 759 RSIFRAGRAAITERHAAAVTLLSRLP 784 >08_02_1100 + 24303920-24304001,24304080-24304576,24304745-24304842, 24304982-24305813,24306463-24306645,24306726-24307346 Length = 770 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 176 HTLIATNADGGLNSNYKIGDLMIVK 250 H LI A+ G NS Y +G + IVK Sbjct: 149 HVLITIFANTGSNSVYAVGIITIVK 173 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,671,194 Number of Sequences: 37544 Number of extensions: 144015 Number of successful extensions: 435 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 14,793,348 effective HSP length: 69 effective length of database: 12,202,812 effective search space used: 256259052 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -